4BVY: AIMP3-MRS N-terminal domain complex

Crystal structure of the AIMP3-MRS N-terminal domain complex. Determined by X-ray diffraction at 1.99 Å resolution. Released 16 Jul 2014.

Method: X-ray diffraction
Resolution: 1.99 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 3,052
Mol. weight: 47.11 kDa
Released: 16 Jul 2014

Explore 4BVY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BVY contains 27 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
α-helix	12-18	7
α-helix	19-22	4
β-strand	29-32	4	1
β-strand	50-52	3	1
β-strand	58-59	2	1
α-helix	62-72	11
α-helix	79-87	9
α-helix	88-92	5
α-helix	93-100	8
α-helix	101-105	5
α-helix	111-114	4
α-helix	118-130	13
α-helix	143-156	14
α-helix	159-161	3
α-helix	167-178	12
α-helix	180-190	11
α-helix	194-198	5
α-helix	199-203	5
α-helix	206-207	2

Chain B: 11 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	3-14	12
β-strand	22-25	4	2
β-strand	30-34	5	2
β-strand	40-42	3	2
α-helix	44-54	11
α-helix	58-61	4
α-helix	65-77	13
α-helix	78-82	5
α-helix	91-101	11
α-helix	102-104	3
β-strand	107	1	3
β-strand	110	1	3
α-helix	115-128	14
α-helix	133-138	6
α-helix	140-149	10
α-helix	160-163	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Methionine--tRNA ligase, cytoplasmic	A	protein	232	HOMO SAPIENS	P56192 (AlphaFold model)
Eukaryotic translation elongation factor 1 epsilon-1	B	protein	186	HOMO SAPIENS	O43324 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4BVY_1 METHIONINE--TRNA LIGASE, CYTOPLASMIC (chains A)
MRLFVSDGVPGCLPVLAAAGRARGRAEVLISTVGPQDCVVPFLTRPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGSVRRA
LTHIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTLSTQE
PCQRAAQTVLKQQGVLALRPYLQKQPQPSPAEGRAVTNEPEEEELEHHHHHH

Sequence of entity 2 (B), FASTA

>4BVY_2 EUKARYOTIC TRANSLATION ELONGATION FACTOR 1 EPSILON-1 (chains B)
MRGSHHHHHHGSMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNDGPSLTGLTTIA
AHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYL
TGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFSHIQHYPGIRQHLSSVVFIKNR
LYTNSH

Primary citation

Crystal Structure of the Aimp3-Mrs N-Terminal Domain Complex. Cho, H.Y., Seo, W.W., Cho, H.J. et al. To be published.

Other PDB entries of the same protein (UniProt P56192 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BVX 1.6 Å, Crystal structure of the AIMP3-MRS N-terminal domain complex with I3C
4BL7 1.89 Å, Crystal structure of the AIMP3-MRS N-terminal domain complex in different space group
5GL7 2.01 Å, Crystal structure of a truncated human cytosolic methionyl-tRNA synthetase
5GOY 2.28 Å, The crystal structure of human cytosolic methionyl-tRNA synthetase in complex with…
5Y6L 2.9 Å, A subcomplex crystal structure of human cytosolic aspartyl-tRNA synthetase and…
2DJV Solution structures of the WHEP-TRS domain of human methionyl-tRNA synthetase

Browse structure collections

About this viewer

MolViewer shows 4BVY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.