2UZK: Human FOXO3a-DBD

Crystal structure of the human FOXO3a-DBD bound to DNA. Determined by X-ray diffraction at 2.7 Å resolution. Released 13 May 2008.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: HOMO SAPIENS
Chains: 6
Atoms: 2,741
Mol. weight: 37.92 kDa
Released: 13 May 2008

Explore 2UZK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2UZK contains 6 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	162-169	8
β-strand	178	1	1
α-helix	180-189	10
α-helix	206-216	11
β-strand	220-223	4	1
β-strand	224-225	2	2
β-strand	233-236	4	1

Chain C: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	1162-1172	11
β-strand	1177-1178	2	2
α-helix	1180-1190	11
α-helix	1206-1216	11
β-strand	1220-1224	5	2
β-strand	1232-1236	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Forkhead box protein O3A	A, C	protein	97	HOMO SAPIENS	O43524 (AlphaFold model)
5'-d(cptpaptpgptpapapapcpapap*c)-3'	B, D	DNA	13	HOMO SAPIENS
5'-d(gptptpgptptptpapcpaptpap*g)-3'	E, F	DNA	13	HOMO SAPIENS

Sequence of entity 1 (A, C), FASTA

>2UZK_1 FORKHEAD BOX PROTEIN O3A (chains A, C)
MGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSL
HSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVS

Sequence of entity 2 (B, D), FASTA

>2UZK_2 5'-D(*CP*TP*AP*TP*GP*TP*AP*AP*AP*CP*AP*AP*C)-3' (chains B, D)
CTATGTAAACAAC

Sequence of entity 3 (E, F), FASTA

>2UZK_3 5'-D(*GP*TP*TP*GP*TP*TP*TP*AP*CP*AP*TP*AP*G)-3' (chains E, F)
GTTGTTTACATAG

Primary citation

Crystal Structure of the Human Foxo3A-Dbd/DNA Complex Suggests the Effects of Post-Translational Modification. Tsai, K.-L., Sun, Y.-J., Huang, C.-Y. et al. Nucleic Acids Res (2007) 35:6984. DOI 10.1093/NAR/GKM703 · PubMed

Other PDB entries of the same protein (UniProt O43524 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QNG 1.35 Å, FOXO3 pS413 phosphopeptide binding to 14-3-3sigma
7V9B 1.85 Å, Crystal Structure of 14-3-3 epsilon with FOXO3a peptide
2K86 Solution Structure of FOXO3a Forkhead domain
2LQH NMR structure of FOXO3a transactivation domains (CR2C-CR3) in complex with CBP KIX…
2LQI NMR structure of FOXO3a transactivation domains (CR2C-CR3) in complex with CBP KIX…
6MNL NMR solution structures of second bromodomain of BRD4 with FOXO3a peptide

Browse structure collections

About this viewer

MolViewer shows 2UZK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.