2LQI: FOXO3a transactivation domains

NMR structure of FOXO3a transactivation domains (CR2C-CR3) in complex with CBP KIX domain (2l3b conformation). Determined by solution NMR. Released 16 May 2012.

Method: Solution NMR
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 1,088
Mol. weight: 15.56 kDa
Released: 16 May 2012

Explore 2LQI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LQI contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	5-9	5
α-helix	12-26	15
α-helix	32-36	5
α-helix	38-57	20
α-helix	61-84	24

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	109-118	10
α-helix	119-121	3
α-helix	138-140	3
α-helix	142-144	3
α-helix	145-150	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CREB-binding protein	A	protein	87	Mus musculus	P45481 (AlphaFold model)
Forkhead box O3	B	protein	52	Homo sapiens	O43524 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LQI_1 CREB-binding protein (chains A)
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANS
RDEYYHLLAEKIYKIQKELEEKRRSRL

Sequence of entity 2 (B), FASTA

>2LQI_2 Forkhead box O3 (chains B)
GSMSHYGNQTLQDLLTSDSLSHSDGGGSGGGSGGGSLECDMESIIRSELMDA

Primary citation

Structures of KIX domain of CBP in complex with two FOXO3a transactivation domains reveal promiscuity and plasticity in coactivator recruitment. Wang, F., Marshall, C.B., Yamamoto, K. et al. Proc Natl Acad Sci U S A (2012) 109:6078-6083. DOI 10.1073/pnas.1119073109 · PubMed

Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0I 1.43 Å, CREBBP Bromodomain in complex with Cpd8 (1-(3-(7-(difluoromethyl)-6-(1-methyl-1H-pyrazol-…
8CNB 1.99 Å, Crystal structure of CREBBP-Y1503C histone acetyltransferase domain in complex with…
4I9O 2.0 Å, Crystal Structure of GACKIX L664C Tethered to 1-10
7LVS 2.02 Å, The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide
8CMZ 2.25 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with…
6DNQ 2.35 Å, HBZ77 in complex with KIX and c-Myb
5U7G 2.4 Å, Crystal Structure of the Catalytic Core of CBP
8CN0 2.44 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with…
8CNA 2.46 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with a…
8OG2 2.47 Å, Crystal structure of CREBBP histone acetyltransferase domain in complex with Coenzyme A
6DMX 2.8 Å, HBZ56 in complex with KIX and c-Myb
8CND 2.97 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with a…

Browse structure collections

About this viewer

MolViewer shows 2LQI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.