6MNL: Second bromodomain of BRD4 with FOXO3a peptide

NMR solution structures of second bromodomain of BRD4 with FOXO3a peptide. Determined by solution NMR. Released 31 Oct 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,160
Mol. weight: 16.6 kDa
Released: 31 Oct 2018

Explore 6MNL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MNL contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	348-364	17
α-helix	374-377	4
α-helix	382-385	4
α-helix	400-409	10
α-helix	415-432	18
α-helix	438-454	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FOXO3a peptide	A	protein	16	Homo sapiens	O43524 (AlphaFold model)
Bromodomain-containing protein 4	B	protein	128	Homo sapiens	O60885 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6MNL_1 FOXO3a peptide (chains A)
NPDGGKSGKAPRRRAV

Sequence of entity 2 (B), FASTA

>6MNL_2 Bromodomain-containing protein 4 (chains B)
KDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCD
IIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEM
RFAKMPDE

Primary citation

Targeting the BRD4/FOXO3a/CDK6 axis sensitizes AKT inhibition in luminal breast cancer. Liu, J., Duan, Z., Guo, W. et al. Nat Commun (2018) 9:5200-5200. DOI 10.1038/s41467-018-07258-y · PubMed

Other PDB entries of the same protein (UniProt O43524 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QNG 1.35 Å, FOXO3 pS413 phosphopeptide binding to 14-3-3sigma
7V9B 1.85 Å, Crystal Structure of 14-3-3 epsilon with FOXO3a peptide
2UZK 2.7 Å, Crystal structure of the human FOXO3a-DBD bound to DNA
2K86 Solution Structure of FOXO3a Forkhead domain
2LQH NMR structure of FOXO3a transactivation domains (CR2C-CR3) in complex with CBP KIX…
2LQI NMR structure of FOXO3a transactivation domains (CR2C-CR3) in complex with CBP KIX…

Browse structure collections

About this viewer

MolViewer shows 6MNL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.