N- and C-terminal helices of oat LOV2 (404-546) are involved in light-induced signal transduction (room temperature (293K) light structure of LOV2 (404-546)). Determined by X-ray diffraction at 1.55 Å resolution. Released 11 Dec 2007.
Explore 2V1B in 3D Show helices and sheets RCSB PDB PDBe
2V1B contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 404-406 | 3 | |
| α-helix | 408-410 | 3 | |
| β-strand | 415-418 | 4 | 1 |
| β-strand | 427-430 | 4 | 1 |
| α-helix | 432-438 | 7 | |
| α-helix | 442-445 | 4 | |
| α-helix | 450-453 | 4 | |
| α-helix | 460-471 | 12 | |
| β-strand | 476-483 | 8 | 1 |
| β-strand | 489-500 | 12 | 1 |
| β-strand | 506-516 | 11 | 1 |
| α-helix | 522-543 | 22 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NPH1-1 | A | protein | 144 | AVENA SATIVA | O49003 (AlphaFold model) |
>2V1B_1 NPH1-1 (chains A) FLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRAT VRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRD AAEREGVMLIKKTAENIDEAAKEL
| ID | Name | Formula | Copies |
|---|---|---|---|
| FMN | Flavin mononucleotide | C17 H21 N4 O9 P | 1 |
Water and common crystallization additives (GOL) are not listed.
N- and C-Terminal Flanking Regions Modulate Light-Induced Signal Transduction in the Lov2 Domain of the Blue Light Sensor Phototropin 1 from Avena Sativa. Halavaty, A.S., Moffat, K. Biochemistry (2007) 46:14001. DOI 10.1021/BI701543E · PubMed
Other PDB entries of the same protein (UniProt O49003 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2V1B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.