2V26: Myosin VI (MD) pre-powerstroke state

Myosin VI (MD) pre-powerstroke state (Mg.ADP.VO4). Determined by X-ray diffraction at 1.75 Å resolution. Released 20 Nov 2007.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: SUS SCROFA
Chains: 1
Atoms: 6,665
Mol. weight: 90.63 kDa
Ligands: MG, VO4, ADP
Released: 20 Nov 2007

Explore 2V26 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2V26 contains 48 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 48 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	15-19	5	1
β-strand	20-24	5	2
β-strand	28-32	5	2
β-strand	41-44	4	2
α-helix	45-47	3
β-strand	49-50	2	1
β-strand	61	1	3
α-helix	62-64	3
α-helix	70-82	13
β-strand	87-90	4	3
β-strand	93-97	5	3
α-helix	109-115	7
α-helix	118-119	2
α-helix	127-141	15
β-strand	145-150	6	3
α-helix	157-172	16
α-helix	181-184	4
α-helix	186-193	8
β-strand	194-195	2	4
β-strand	203-204	2	4
β-strand	207-214	8	3
β-strand	220-228	9	3
α-helix	233-235	3
β-strand	245	1	4
α-helix	246-254	9
α-helix	257-262	6
α-helix	268-270	3
α-helix	272-275	4
α-helix	280-281	2
β-strand	282	1	5
α-helix	285-288	4
α-helix	293-295	3
α-helix	298-303	6
β-strand	306	1	5
α-helix	313-326	14
α-helix	331-348	18
β-strand	352-354	3	6
β-strand	362-364	3	6
α-helix	366-368	3
α-helix	369-379	11
α-helix	383-391	9
β-strand	392-394	3	7
β-strand	408-410	3	7
α-helix	411-412	2
α-helix	413-440	28
β-strand	450-456	7	3
α-helix	457-460	4
α-helix	468-484	17
α-helix	485-490	6
α-helix	491-498	8
α-helix	503-505	3
α-helix	512-519	8
α-helix	525-534	10
α-helix	540-550	11
β-strand	557-558	2	8
α-helix	560-562	3
α-helix	566-568	3
β-strand	576-581	6	8
β-strand	584-589	6	8
α-helix	593-596	4
β-strand	598	1	9
α-helix	603-610	8
α-helix	615-620	6
β-strand	642	1	9
α-helix	643-659	17
β-strand	662-669	8	3
α-helix	682-691	10
α-helix	694-701	8
β-strand	707-710	4	10
α-helix	711-718	8
α-helix	719-721	3
α-helix	724-727	4
α-helix	731-741	11
α-helix	746-748	3
β-strand	749-751	3	10
β-strand	755-758	4	10
α-helix	763-770	8
α-helix	774-787	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin VI	A	protein	784	SUS SCROFA	Q29122 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2V26_1 MYOSIN VI (chains A)
KPVWAPHPTDGFQVGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCS
LMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSETIKSYQGKSLGTMP
PHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVE
ANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERN
YHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAG
SLKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNL
KNKSTQALEYCAELLGLDQDDLRVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALA
KTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFF
NERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEARLVGILDILDEENRLPQPSDQHFT
SAVHQKHKDHFRLSIPRKSKLAIHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMS
LESLICESRDKFIRELFESSTNNNKDTKQKAGKLSFISVGNKFKTQLNLLLDKLRSTGAS
FIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPD
KLARLDPRLFCKALFKALGLNEIDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRV
NHWL

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
VO4	Vanadate ion	O4 V	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Water and common crystallization additives (SO4, EDO) are not listed.

Primary citation

The Structural Basis for the Large Powerstroke of Myosin Vi. Menetrey, J., Llinas, P., Mukherjea, M. et al. Cell (2007) 131:300. DOI 10.1016/J.CELL.2007.08.027 · PubMed

Other PDB entries of the same protein (UniProt Q29122 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DBR 1.95 Å, Myosin VI D179Y (MD) pre-powerstroke state
2X51 2.2 Å, M6 delta Insert1
3L9I 2.2 Å, Myosin VI nucleotide-free (mdinsert2) L310G mutant crystal structure
4DBP 2.2 Å, Myosin VI nucleotide-free (MDINSERT2) D179Y crystal structure
5O2L 2.2 Å, Myosin VI motor domain in the Pre-Transition State
2VB6 2.3 Å, Myosin VI (MD-insert2-CaM, Delta Insert1) Post-rigor state (crystal form 2)
2BKH 2.4 Å, Myosin VI nucleotide-free (MDInsert2) crystal structure
2VAS 2.4 Å, Myosin VI (MD-insert2-CaM, Delta-Insert1) Post-rigor state
4ANJ 2.6 Å, MYOSIN VI (MDinsert2-GFP fusion) PRE-POWERSTROKE STATE (MG.ADP.AlF4)
4DBQ 2.6 Å, MYOSIN VI D179Y (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state
3GN4 2.7 Å, Myosin lever arm
2BKI 2.9 Å, Myosin VI nucleotide-free (MDinsert2-IQ) crystal structure

Browse structure collections

About this viewer

MolViewer shows 2V26 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.