2X51: M6 delta Insert1

M6 delta Insert1. Determined by X-ray diffraction at 2.2 Å resolution. Released 26 Jan 2011.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: SUS SCROFA, DROSOPHILA MELANOGASTER
Chains: 2
Atoms: 7,401
Mol. weight: 107.72 kDa
Ligands: CA
Released: 26 Jan 2011

Explore 2X51 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2X51 contains 45 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	15-19	5	1
β-strand	28-30	3	2
β-strand	42-44	3	2
α-helix	45-47	3
β-strand	49-50	2	1
β-strand	61	1	3
α-helix	62-64	3
α-helix	70-82	13
β-strand	87-90	4	3
β-strand	93-97	5	3
α-helix	109-114	6
α-helix	118-119	2
α-helix	127-141	15
β-strand	145-150	6	3
α-helix	157-172	16
α-helix	178-193	16
β-strand	194-195	2	4
β-strand	203-204	2	4
β-strand	207-214	8	3
β-strand	220-228	9	3
α-helix	233-235	3
β-strand	245	1	4
α-helix	246-254	9
α-helix	257-262	6
α-helix	268-270	3
α-helix	313-326	14
α-helix	331-347	17
β-strand	352-354	3	5
β-strand	362-364	3	5
α-helix	366-368	3
α-helix	369-378	10
α-helix	383-391	9
β-strand	392-393	2	6
β-strand	409-410	2	6
α-helix	413-441	29
β-strand	450-456	7	3
β-strand	466	1	7
α-helix	468-498	31
α-helix	512-519	8
α-helix	525-533	9
α-helix	540-550	11
β-strand	557-558	2	7
α-helix	560-562	3
β-strand	576-581	6	7
β-strand	584-589	6	7
α-helix	593-596	4
α-helix	600-602	3
α-helix	603-610	8
α-helix	615-620	6
α-helix	643-659	17
β-strand	662-669	8	3
α-helix	682-691	10
α-helix	694-701	8
β-strand	707-710	4	8
α-helix	711-718	8
α-helix	719-721	3
α-helix	724-727	4
α-helix	731-742	12
β-strand	749-751	3	8
β-strand	755-758	4	8
α-helix	762-770	9
α-helix	774-782	9
α-helix	785-814	30

Chain B: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-20	14
β-strand	28	1	9
α-helix	30-39	10
α-helix	46-54	9
β-strand	64	1	9
α-helix	66-73	8
α-helix	82-93	12
β-strand	100-101	2	10
α-helix	103-112	10
α-helix	119-129	11
β-strand	137-138	2	10
α-helix	139-146	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-VI	A	protein	789	SUS SCROFA	Q29122 (AlphaFold model)
Calmodulin	B	protein	149	DROSOPHILA MELANOGASTER	P62152 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2X51_1 MYOSIN-VI (chains A)
MEDGKPVWAPHPTDGFQVGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVE
DNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSETIKSYQGKSL
GTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDD
RIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGK
EERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGGSLKDPLLDDHGDFIRMCTAMKK
IGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSTQALEYCAELLGLDQDDL
RVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFE
TSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEV
HYVDNQDCIDLIEARLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLSIPRKSKLA
IHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESRDKFIRELFESSTN
NNKDTKQKAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQIL
SQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNE
IDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLICSRWKKVQWCSLSVIKL
KNKIKYRAE

Sequence of entity 2 (B), FASTA

>2X51_2 CALMODULIN (chains B)
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVTMMTSK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3

Water and common crystallization additives (GOL, SO4) are not listed.

Primary citation

Role of Insert-1 of Myosin Vi in Modulating Nucleotide Affinity. Pylypenko, O., Song, L., Squires, G. et al. J Biol Chem (2011) 286:11716. DOI 10.1074/JBC.M110.200626 · PubMed

Other PDB entries of the same protein (UniProt Q29122 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V26 1.75 Å, Myosin VI (MD) pre-powerstroke state (Mg.ADP.VO4)
4DBR 1.95 Å, Myosin VI D179Y (MD) pre-powerstroke state
3L9I 2.2 Å, Myosin VI nucleotide-free (mdinsert2) L310G mutant crystal structure
4DBP 2.2 Å, Myosin VI nucleotide-free (MDINSERT2) D179Y crystal structure
5O2L 2.2 Å, Myosin VI motor domain in the Pre-Transition State
2VB6 2.3 Å, Myosin VI (MD-insert2-CaM, Delta Insert1) Post-rigor state (crystal form 2)
2BKH 2.4 Å, Myosin VI nucleotide-free (MDInsert2) crystal structure
2VAS 2.4 Å, Myosin VI (MD-insert2-CaM, Delta-Insert1) Post-rigor state
4ANJ 2.6 Å, MYOSIN VI (MDinsert2-GFP fusion) PRE-POWERSTROKE STATE (MG.ADP.AlF4)
4DBQ 2.6 Å, MYOSIN VI D179Y (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state
3GN4 2.7 Å, Myosin lever arm
2BKI 2.9 Å, Myosin VI nucleotide-free (MDinsert2-IQ) crystal structure

Browse structure collections

About this viewer

MolViewer shows 2X51 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.