2V33: E1 envelope glycoprotein

High resolution crystal structure of domain III of E1 fusion glycoprotein of Semliki Forest Virus. Determined by X-ray diffraction at 1.55 Å resolution. Released 22 Jul 2008.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: SEMLIKI FOREST VIRUS
Chains: 2
Atoms: 1,576
Mol. weight: 18.82 kDa
Released: 22 Jul 2008

Explore 2V33 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2V33 contains 2 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
α-helix	293-295	3
β-strand	296-306	11	1
β-strand	307	1	2
β-strand	309-322	14	1
β-strand	326-329	4	3
β-strand	330-331	2	4
β-strand	337-339	3	1
β-strand	341	1	5
β-strand	343-346	4	3
β-strand	351-358	8	1
β-strand	364-369	6	4
β-strand	372-377	6	4
β-strand	381	1	2

Chain B: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
α-helix	293-295	3
β-strand	296-305	10	6
β-strand	307	1	7
β-strand	314-322	9	6
β-strand	326-329	4	8
β-strand	330-332	3	9
β-strand	337-339	3	6
β-strand	341	1	5
β-strand	343-346	4	8
β-strand	351-358	8	6
β-strand	364-369	6	9
β-strand	372-377	6	9
β-strand	381	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E1 envelope glycoprotein	A, B	protein	91	SEMLIKI FOREST VIRUS	P03315 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2V33_1 E1 ENVELOPE GLYCOPROTEIN (chains A, B)
EAPTIIDLTCTVATCTHSSDFGGVLTLTYKTNKNGDCSVHSHSNVATLQEATAKVKTAGK
VTLHFSTASASPSFVVSLCSARATCSASCEP

Primary citation

High Resolution Structure of Domain III from Class II Fusion Protein of Semliki Forest Virus. Vaney, M.C., Vigouroux, A., Rey, F.A. To be published.

Other PDB entries of the same protein (UniProt P03315 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1I9W 3.0 Å, Crystal structure of the fusion glycoprotein E1 from semliki forest virus
1VCP 3.0 Å, Semliki forest virus capsid protein (crystal form I)
2ALA 3.0 Å, Crystal structure of the Semliki Forest Virus envelope protein E1 in its monomeric…
8IHP 3.0 Å, Structure of Semliki Forest virus VLP in complex with the receptor VLDLR-LA3
8YVY 3.02 Å, Semliki Forest virus virion
1VCQ 3.1 Å, Semliki forest virus capsid protein (crystal form II)
1RER 3.2 Å, Crystal structure of the homotrimer of fusion glycoprotein E1 from Semliki Forest Virus.
8YW1 3.44 Å, Semliki Forest virus viron in complex with VLDLR
8YVZ 3.45 Å, Semliki Forest virus viron
8X0K 3.5 Å, Cryo-EM structure of Semliki Forest virus in complex with its receptor VLDLR(2-fold)
8X0L 3.5 Å, Cryo-EM structure of Semliki Forest virus in complex with its receptor VLDLR(3-fold)
8X0M 3.5 Å, Cryo-EM structure of Semliki Forest virus in complex with its receptor VLDLR(5-fold)

Browse structure collections

About this viewer

MolViewer shows 2V33 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.