2VB6: Myosin VI

Myosin VI (MD-insert2-CaM, Delta Insert1) Post-rigor state (crystal form 2). Determined by X-ray diffraction at 2.3 Å resolution. Released 11 Dec 2007.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: SUS SCROFA, GALLUS GALLUS
Chains: 2
Atoms: 7,271
Mol. weight: 107.42 kDa
Ligands: CA, MG, BEF, ADP
Released: 11 Dec 2007

Explore 2VB6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VB6 contains 45 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	15-24	10	1
β-strand	28-33	6	1
β-strand	41-44	4	1
α-helix	45-47	3
β-strand	49-50	2	1
β-strand	61	1	2
α-helix	62-64	3
α-helix	70-82	13
β-strand	87-90	4	2
β-strand	93-97	5	2
α-helix	109-115	7
α-helix	118-119	2
β-strand	120	1	3
β-strand	123	1	3
α-helix	127-141	15
β-strand	145-150	6	2
α-helix	157-172	16
α-helix	177-193	17
β-strand	194-195	2	4
β-strand	203-204	2	4
β-strand	207-214	8	2
β-strand	220-228	9	2
α-helix	233-235	3
β-strand	245	1	4
α-helix	246-254	9
α-helix	257-263	7
α-helix	268-270	3
α-helix	313-327	15
α-helix	331-347	17
α-helix	369-378	10
α-helix	383-389	7
α-helix	413-440	28
β-strand	450-456	7	2
β-strand	466	1	5
α-helix	468-499	32
α-helix	512-519	8
α-helix	525-534	10
α-helix	540-550	11
β-strand	557-558	2	5
α-helix	560-562	3
α-helix	566-569	4
α-helix	573-575	3
β-strand	576-581	6	5
β-strand	584-589	6	5
α-helix	593-596	4
β-strand	598	1	6
α-helix	603-610	8
α-helix	615-620	6
β-strand	642	1	6
α-helix	643-659	17
β-strand	662-669	8	2
α-helix	682-691	10
α-helix	694-702	9
β-strand	707-710	4	7
α-helix	711-718	8
α-helix	719-721	3
α-helix	724-727	4
α-helix	731-742	12
β-strand	749-751	3	7
β-strand	755-758	4	7
α-helix	762-771	10
α-helix	774-782	9
α-helix	785-812	28

Chain B: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	26-27	2	8
α-helix	29-38	10
α-helix	45-55	11
β-strand	63-64	2	8
α-helix	65-71	7
α-helix	80-92	13
β-strand	100	1	9
α-helix	102-111	10
α-helix	118-128	11
β-strand	136	1	9
α-helix	138-145	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin VI	A	protein	788	SUS SCROFA	Q29122 (AlphaFold model)
Calmodulin	B	protein	149	GALLUS GALLUS	P62149 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2VB6_1 MYOSIN VI (chains A)
EDGKPVWAPHPTDGFQVGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVED
NCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSETIKSYQGKSLG
TMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDR
IVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKE
ERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGGSLKDPLLDDHGDFIRMCTAMKKI
GLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSTQALEYCAELLGLDQDDLR
VSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFET
SSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVH
YVDNQDCIDLIEARLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLSIPRKSKLAI
HRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESRDKFIRELFESSTNN
NKDTKQKAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILS
QLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNEI
DYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLICSRWKKVQWCSLSVIKLK
NKIKYRAE

Sequence of entity 2 (B), FASTA

>2VB6_2 CALMODULIN (chains B)
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE
EVDEMIRESDIDGDGQVNYEEFVTMMTSK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4
MG	Magnesium ion	Mg	1
BEF	Beryllium trifluoride ion	Be F3	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Primary citation

The Post-Rigor Structure of Myosin Vi and Implications for the Recovery Stroke. Menetrey, J., Llinas, P., Cicolari, J. et al. EMBO J (2008) 27:244. DOI 10.1038/SJ.EMBOJ.7601937 · PubMed

Other PDB entries of the same protein (UniProt Q29122 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V26 1.75 Å, Myosin VI (MD) pre-powerstroke state (Mg.ADP.VO4)
4DBR 1.95 Å, Myosin VI D179Y (MD) pre-powerstroke state
2X51 2.2 Å, M6 delta Insert1
3L9I 2.2 Å, Myosin VI nucleotide-free (mdinsert2) L310G mutant crystal structure
4DBP 2.2 Å, Myosin VI nucleotide-free (MDINSERT2) D179Y crystal structure
5O2L 2.2 Å, Myosin VI motor domain in the Pre-Transition State
2BKH 2.4 Å, Myosin VI nucleotide-free (MDInsert2) crystal structure
2VAS 2.4 Å, Myosin VI (MD-insert2-CaM, Delta-Insert1) Post-rigor state
4ANJ 2.6 Å, MYOSIN VI (MDinsert2-GFP fusion) PRE-POWERSTROKE STATE (MG.ADP.AlF4)
4DBQ 2.6 Å, MYOSIN VI D179Y (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state
3GN4 2.7 Å, Myosin lever arm
2BKI 2.9 Å, Myosin VI nucleotide-free (MDinsert2-IQ) crystal structure

Browse structure collections

About this viewer

MolViewer shows 2VB6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.