2VL5: Anti-collagen type II FAb CIIC1

Structure of anti-collagen type II FAb CIIC1. Determined by X-ray diffraction at 2.1 Å resolution. Released 18 Mar 2008.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: MUS MUSCULUS
Chains: 4
Atoms: 7,164
Mol. weight: 94.94 kDa
Released: 18 Mar 2008

Explore 2VL5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VL5 contains 35 α-helices and 89 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
β-strand	9-12	4	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	45-52	8	2
β-strand	57-60	4	2
α-helix	62-64	3
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-98	7	2
α-helix	99-100	2
β-strand	108-109	2	2
β-strand	113-117	5	2
α-helix	121-122	2
β-strand	123	1	3
β-strand	126-130	5	4
α-helix	131-133	3
β-strand	141-151	11	4
β-strand	152	1	3
β-strand	157-160	4	5
α-helix	161-163	3
β-strand	165	1	5
β-strand	169-171	3	4
α-helix	172-174	3
β-strand	175-177	3	4
β-strand	180-190	11	4
α-helix	191-193	3
β-strand	200-205	6	5
α-helix	206-208	3
β-strand	210-215	6	5

Chain B: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-14	5	7
β-strand	19-25	7	6
β-strand	30-31	2	8
β-strand	34-35	2	8
β-strand	37-42	6	7
β-strand	49-53	5	7
β-strand	57-58	2	7
α-helix	59	1
β-strand	66-71	6	6
β-strand	74-79	6	6
α-helix	84-86	3
β-strand	88-94	7	7
β-strand	102	1	7
β-strand	106-111	6	7
β-strand	115	1	9
α-helix	116-117	2
β-strand	118-122	5	10
α-helix	123-125	3
α-helix	128-130	3
β-strand	133-143	11	10
β-strand	144	1	9
β-strand	148-154	7	11
β-strand	157-158	2	11
β-strand	163-167	5	10
α-helix	168-171	4
β-strand	177-186	10	10
α-helix	187-191	5
β-strand	195-202	8	11
β-strand	209-214	6	11

Chain C: 13 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	12
β-strand	9-12	4	13
β-strand	18-25	8	12
α-helix	29-31	3
β-strand	34-40	7	13
β-strand	44-52	9	13
β-strand	57-60	4	13
α-helix	62-64	3
β-strand	68-73	6	12
α-helix	74-76	3
β-strand	78-83	6	12
α-helix	84	1
α-helix	88-90	3
β-strand	92-98	7	13
α-helix	99-100	2
β-strand	108-109	2	13
β-strand	113-117	5	13
α-helix	121-122	2
β-strand	123	1	14
α-helix	124-125	2
β-strand	126-130	5	15
α-helix	131-133	3
β-strand	141-151	11	15
β-strand	152	1	14
β-strand	157-160	4	16
α-helix	161-163	3
β-strand	169-171	3	15
α-helix	172-174	3
β-strand	175-177	3	15
β-strand	180-190	11	15
α-helix	191-193	3
β-strand	200-205	6	16
α-helix	206-208	3
β-strand	210-215	6	16

Chain D: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	17
β-strand	10-14	5	18
β-strand	19-25	7	17
β-strand	30-31	2	19
β-strand	34-35	2	19
β-strand	37-42	6	18
β-strand	49-53	5	18
β-strand	57-58	2	18
α-helix	59	1
β-strand	66-71	6	17
β-strand	74-79	6	17
α-helix	84-86	3
β-strand	88-94	7	18
β-strand	102	1	18
β-strand	106-111	6	18
β-strand	115	1	20
β-strand	118-122	5	21
α-helix	123-125	3
α-helix	126-131	6
β-strand	133-143	11	21
β-strand	144	1	20
β-strand	149-154	6	22
β-strand	157-159	3	22
β-strand	163-167	5	21
β-strand	177-186	10	21
α-helix	187-190	4
β-strand	195-201	7	22
β-strand	209-214	6	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CIIC1 anticollagen FAB	A, C	protein	218	MUS MUSCULUS	P01863 (AlphaFold model)
CIIC1 anticollagen FAB	B, D	protein	218	MUS MUSCULUS	P01660 (AlphaFold model), P01837 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2VL5_1 CIIC1 ANTICOLLAGEN FAB (chains A, C)
QVQLQQPGADLVRPGVSVKLSCKASGYTFTSYWMNWVKQRPGQGLEWIGMIHPSDSETRL
SQKFKDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCARLKPGGTWFAYWGQGTLVTVSAA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP

Sequence of entity 2 (B, D), FASTA

>2VL5_2 CIIC1 ANTICOLLAGEN FAB (chains B, D)
DIVLTQSPASLTVSLGQRATISCRASKSVDSYGNSFMEWYQQKPGQPPKLLIYRASNLES
GIPARFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDPYTFGGGTKLEIKRADAAPTVS
IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS
STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Primary citation

The Crystal Structure of the Pathogenic Collagen Type II-Specific Mouse Monoclonal Antibody Ciic1 Fab: Structure to Function Analysis. Uysal, H., Sehnert, B., Nandakumar, K.S. et al. Mol Immunol (2008) 45:2196. DOI 10.1016/J.MOLIMM.2007.12.005 · PubMed

Other PDB entries of the same protein (UniProt P01863 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VAA 1.55 Å, Crystal structure of mouse IgG2a Fc T370K mutant
3OZ9 1.6 Å, Crystal Structure of anti-gp41 Fab NC-1
2IPU 1.65 Å, PFA1 Fab fragment complexed with Abeta 1-8 peptide
1DQQ 1.8 Å, Crystal structure of anti-lysozyme antibody hyhel-63
1YEJ 1.85 Å, Catalytic antibody complex
1KN2 1.9 Å, Catalytic antibody D2.3 complex
1KN4 1.9 Å, Catalytic antibody D2.3 complex
1YEC 1.9 Å, Structure of a catalytic antibody IGG2A FAB fragment (D2.3)
1YEI 1.9 Å, Catalytic antibody D2.3 complex
1UYW 2.0 Å, Crystal Structure of the antiflavivirus Fab4g2
1YEF 2.0 Å, Structure of IGG2A FAB fragment (D2.3) complexed with substrate analogue
1YEG 2.0 Å, Structure of IGG2A FAB fragment (D2.3) complexed with reaction product

Browse structure collections

About this viewer

MolViewer shows 2VL5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.