2VPH: Tyrosine-protein phosphatase non-receptor type 4

Crystal structure of the human protein tyrosine phosphatase, non- receptor type 4, PDZ domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 18 Mar 2008.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,496
Mol. weight: 22.08 kDa
Released: 18 Mar 2008

Explore 2VPH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VPH contains 11 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	516-520	5	1
β-strand	530-535	6	1
α-helix	536-538	3
β-strand	540-547	8	1
α-helix	552-555	4
α-helix	559-560	2
α-helix	564	1
β-strand	565-569	5	1
β-strand	572-573	2	1
α-helix	579-587	9
α-helix	589-591	3
β-strand	593	1	2
β-strand	596	1	2
β-strand	597-602	6	1
β-strand	607-609	3	3

Chain B: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	516-520	5	3
β-strand	530-535	6	3
α-helix	536-538	3
β-strand	540-547	8	3
α-helix	552-555	4
α-helix	559-560	2
α-helix	564	1
β-strand	565-569	5	3
β-strand	572-573	2	3
α-helix	579-587	9
β-strand	597-602	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 4	A, B	protein	100	HOMO SAPIENS	P29074 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2VPH_1 TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE 4 (chains A, B)
SMDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLIN
GRDIAEHTHDQVVLFIKASCERHSGELMLLVRPNAVESTV

Primary citation

Crystal Structure of the Human Protein Tyrosine Phosphatase, Non-Receptor Type 4, Pdz Domain. Roos, A.K., Wang, J., Burgess-Brown, N. et al. To be published.

Other PDB entries of the same protein (UniProt P29074 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NFK 1.43 Å, Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of a rabies…
3NFL 1.91 Å, Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of the GluN2A…
5EYZ 2.09 Å, Crystal structure of the PTPN4 PDZ domain complexed with the tailored peptide CYTO8-retev
5EZ0 2.35 Å, Crystal structure of the PTPN4 PDZ domain complexed with the PDZ binding motif of the…
2I75 2.45 Å, Crystal Structure of Human Protein Tyrosine Phosphatase N4 (PTPN4)
7VZE 2.88 Å, Crystal structure of PTPN4 PDZ bound to the PBM of HPV16 E6
2CS5 Solution structure of PDZ domain of Protein tyrosine phosphatase, non-receptor type 4

Browse structure collections

About this viewer

MolViewer shows 2VPH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.