2VSK: Hendra virus attachment glycoprotein

Hendra virus attachment glycoprotein in complex with human cell surface receptor ephrinB2. Determined by X-ray diffraction at 3.3 Å resolution. Released 20 May 2008.

Method: X-ray diffraction
Resolution: 3.3 Å
Organisms: Hendra virus, Homo sapiens
Chains: 4
Atoms: 8,443
Mol. weight: 125.11 kDa
Released: 20 May 2008

Explore 2VSK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VSK contains 17 α-helices and 112 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	201-202	2	1
β-strand	215-226	12	2
β-strand	228-237	10	2
β-strand	244-257	14	2
β-strand	263-271	9	2
β-strand	279-287	9	3
β-strand	290-297	8	3
α-helix	303-305	3
α-helix	307-309	3
β-strand	314-320	7	3
β-strand	332-335	4	3
β-strand	340-341	2	4
β-strand	347-350	4	4
β-strand	354	1	3
β-strand	356-358	3	4
β-strand	361-371	11	4
α-helix	372-374	3
α-helix	379-381	3
α-helix	393-397	5
β-strand	407-417	11	4
β-strand	426-430	5	4
β-strand	431	1	5
α-helix	432	1
β-strand	442-447	6	6
β-strand	450-455	6	6
β-strand	463	1	7
β-strand	465-471	7	6
β-strand	475	1	5
β-strand	476-479	4	6
β-strand	486	1	7
β-strand	509	1	8
β-strand	512-515	4	9
β-strand	520-526	7	9
β-strand	533	1	10
β-strand	535-541	7	9
β-strand	544-550	7	9
β-strand	557-558	2	10
β-strand	561	1	8
β-strand	563-568	6	1
β-strand	571-576	6	1
β-strand	580-581	2	10
β-strand	588	1	2
β-strand	593-594	2	1
β-strand	596	1	1
α-helix	597-598	2

Chain B: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	32	1	11
β-strand	36-37	2	11
β-strand	46	1	12
β-strand	50	1	12
β-strand	51-53	3	13
β-strand	60-65	6	11
α-helix	66-67	2
β-strand	78	1	14
β-strand	79-81	3	15
β-strand	82-84	3	13
α-helix	86-91	6
β-strand	93	1	16
β-strand	102-104	3	15
β-strand	111-116	6	11
β-strand	134-138	5	13
β-strand	143	1	14
β-strand	152	1	16
β-strand	162-166	5	13

Chain C: 6 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	201-202	2	17
β-strand	215-226	12	18
β-strand	228-237	10	18
β-strand	244-255	12	18
β-strand	265-271	7	18
β-strand	279-287	9	19
β-strand	290-297	8	19
α-helix	303-305	3
β-strand	314-320	7	19
β-strand	332-335	4	19
β-strand	340-341	2	20
β-strand	347-350	4	20
β-strand	354	1	19
β-strand	356-357	2	20
β-strand	361-371	11	20
α-helix	372-374	3
α-helix	379-381	3
α-helix	394-397	4
β-strand	407-417	11	20
β-strand	426-430	5	20
β-strand	431	1	21
α-helix	432	1
β-strand	442-447	6	22
β-strand	450-455	6	22
β-strand	463	1	23
β-strand	465-468	4	22
β-strand	469-471	3	24
β-strand	475	1	21
β-strand	476-477	2	24
β-strand	486	1	23
β-strand	505	1	25
β-strand	509	1	26
β-strand	512-515	4	27
β-strand	520-526	7	27
β-strand	533	1	28
β-strand	535-541	7	27
β-strand	544-550	7	27
β-strand	557-558	2	28
β-strand	561	1	26
β-strand	563-568	6	17
β-strand	571-576	6	17
β-strand	579-581	3	28
β-strand	588	1	18
β-strand	589-590	2	28
β-strand	593-594	2	17
β-strand	596	1	17
α-helix	597-598	2

Chain D: 2 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	32	1	29
β-strand	36-37	2	29
β-strand	46	1	30
β-strand	50	1	30
β-strand	51-53	3	31
β-strand	60-65	6	29
α-helix	66-67	2
β-strand	78	1	32
β-strand	79-81	3	33
β-strand	82-84	3	31
α-helix	86-91	6
β-strand	93	1	34
β-strand	102-104	3	33
β-strand	111-116	6	29
β-strand	123	1	25
β-strand	134-138	5	31
β-strand	143	1	32
β-strand	152	1	34
β-strand	162-166	5	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hemagglutinin-neuraminidase	A, C	protein	416	Hendra virus	O89343 (AlphaFold model)
Ephrin-B2	B, D	protein	138	Homo sapiens	P52799 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2VSK_1 HEMAGGLUTININ-NEURAMINIDASE (chains A, C)
ICLQKTTSTILKPRLISYTLPINTREGVCITDPLLAVDNGFFAYSHLEKIGSCTRGIAKQ
RIIGVGEVLDRGDKVPSMFMTNVWTPPNPSTIHHCSSTYHEDFYYTLCAVSHVGDPILNS
TSWTESLSLIRLAVRPKSDSGDYNQKYIAITKVERGKYDKVMPYGPSGIKQGDTLYFPAV
GFLPRTEFQYNDSNCPIIHCKYSKAENCRLSMGVNSKSHYILRSGLLKYNLSLGGDIILQ
FIEIADNRLTIGSPSKIYNSLGQPVFYQASYSWDTMIKLGDVDTVDPLRVQWRNNSVISR
PGQSQCPRFNVCPEVCWEGTYNDAFLIDRLNWVSAGVYLNSNQTAENPVFAVFKDNEILY
QVPLAEDDTNAQKTITDCFLLENVIWCISLVEIYDTGDSVIRPKLFAVKIPAQCSE

Sequence of entity 2 (B, D), FASTA

>2VSK_2 EPHRIN-B2 (chains B, D)
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQAD
RCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDN
QEGGVCQTRAMKILMKVG

Primary citation

Structural Basis of Nipah and Hendra Virus Attachment to Their Cell-Surface Receptor Ephrin-B2. Bowden, T.A., Aricescu, A.R., Gilbert, R.J. et al. Nat Struct Mol Biol (2008) 15:567. DOI 10.1038/NSMB.1435 · PubMed

Other PDB entries of the same protein (UniProt O89343 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VY4 2.0 Å, Crystal structure of Hendra receptor binding protein head domain in complex with human…
6PD4 2.2 Å, Crystal Structure of Hendra Virus Attachment G Glycoprotein
6VY6 2.6 Å, Crystal structure of Hendra receptor binding protein head domain in complex with human…
6CMG 2.7 Å, Crystal Structure of the Hendra Virus Attachment G Glycoprotein Bound to a Potent…
6PDL 2.7 Å, Crystal Structure of Hendra Virus Attachment G Glycoprotein in Complex with Receptor…
6CMI 2.72 Å, Crystal Structure of the Hendra Virus Attachment G Glycoprotein Bound to a Potent…
7SYY 2.74 Å, Hendra virus G protein head domain in complex with cross-neutralizing murine antibody…
7SYZ 2.86 Å, Hendra virus G protein head domain in complex with cross-neutralizing murine antibody…
2X9M 2.9 Å, Hendra virus attachment glycoprotein
8VF1 3.0 Å, Crystal Structure of the Hendra Virus Attachment G glycoprotein (HeV-G)
8JR3 3.22 Å, Crystal structure of Hendra Virus attachment(G) glycoprotein mutant S586N in complex…
8JR5 3.3 Å, Crystal structure of Hendra Virus attachment(G) glycoprotein mutant S586N

Browse structure collections

About this viewer

MolViewer shows 2VSK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.