2VT4: BETA1 adrenergic receptor

Name: PDB 2VT4: Turkey BETA1 adrenergic receptor with stabilising mutations and bound cyanopindolol
Published: 2008-06-24
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: receptor

Turkey BETA1 adrenergic receptor with stabilising mutations and bound cyanopindolol. Determined by X-ray diffraction at 2.7 Å resolution. Released 24 Jun 2008.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: MELEAGRIS GALLOPAVO
Chains: 4
Atoms: 8,976
Mol. weight: 148.24 kDa
Ligands: D10, SOG, P32
Released: 24 Jun 2008

Explore 2VT4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VT4 contains 63 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	41-68	28
α-helix	70-72	3
α-helix	75-89	15
α-helix	90-94	5
α-helix	95-104	10
α-helix	111-142	32
α-helix	146-152	7
α-helix	155-178	24
β-strand	183	1	1
α-helix	187-194	8
β-strand	203	1	1
α-helix	205-212	8
α-helix	213-217	5
α-helix	218-235	18
α-helix	285-315	31
α-helix	322-343	22
α-helix	347-356	10

Chain B: 17 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	40-68	29
α-helix	75-89	15
α-helix	90-94	5
α-helix	95-104	10
α-helix	111-144	34
α-helix	146-152	7
α-helix	155-169	15
α-helix	170-174	5
α-helix	175-178	4
β-strand	183	1	2
α-helix	187-194	8
β-strand	203	1	2
α-helix	205-212	8
α-helix	213-217	5
α-helix	218-235	18
α-helix	285-315	31
α-helix	322-342	21
α-helix	343-345	3
α-helix	347-356	10

Chain C: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	40-68	29
α-helix	75-89	15
α-helix	90-94	5
α-helix	95-104	10
α-helix	111-144	34
α-helix	146-152	7
α-helix	155-169	15
α-helix	170-174	5
α-helix	175-178	4
β-strand	183	1	3
α-helix	187-194	8
β-strand	203	1	3
α-helix	205-212	8
α-helix	213-217	5
α-helix	218-235	18
α-helix	285-315	31
α-helix	322-342	21
α-helix	343-345	3

Chain D: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	42-68	27
α-helix	70-72	3
α-helix	75-89	15
α-helix	90-94	5
α-helix	95-104	10
α-helix	111-142	32
α-helix	146-152	7
α-helix	155-178	24
β-strand	183	1	4
α-helix	187-194	8
β-strand	203	1	4
α-helix	205-212	8
α-helix	213-217	5
α-helix	218-235	18
α-helix	285-315	31
α-helix	322-343	22
α-helix	347-356	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BETA1 adrenergic receptor	A, B, C, D	protein	313	MELEAGRIS GALLOPAVO	P07700 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2VT4_1 BETA1 ADRENERGIC RECEPTOR (chains A, B, C, D)
MGAELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVV
GLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQ
SLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIA
SSIISFYIPLLIMIFVALRVYREAKEQIRKIDRASKRKRVMLMREHKALKTLGIIMGVFT
LCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLAFP
RKADRRLHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
D10	Decane	C10 H22	2
SOG	octyl 1-thio-beta-D-glucopyranoside	C14 H28 O5 S	12
P32	Cyanopindolol	C16 H21 N3 O2	4

Water and common crystallization additives (NA) are not listed.

Primary citation

Structure of a Beta1-Adrenergic G-Protein-Coupled Receptor. Warne, A., Serrano-Vega, M.J., Baker, J.G. et al. Nature (2008) 454:486. DOI 10.1038/NATURE07101 · PubMed

Other PDB entries of the same protein (UniProt P07700 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BVN 2.1 Å, Ultra-thermostable beta1-adrenoceptor with cyanopindolol bound
4AMJ 2.3 Å, Turkey beta1 adrenergic receptor with stabilising mutations and bound biased agonist…
5A8E 2.4 Å, thermostabilised beta1-adrenoceptor with rationally designed inverse agonist…
2Y00 2.5 Å, Turkey BETA1 adrenergic receptor with stabilising mutations and bound partial agonist…
6H7N 2.5 Å, Activated turkey BETA1 adrenoceptor with bound partial agonist xamoterol and nanobody…
8DCS 2.5 Å, Cryo-EM structure of cyanopindolol-bound beta1-adrenergic receptor in complex with…
2Y01 2.6 Å, Turkey BETA1 adrenergic receptor with stabilising mutations and bound partial agonist…
2Y02 2.6 Å, Turkey BETA1 adrenergic receptor with stabilising mutations and bound agonist carmoterol
7JJO 2.6 Å, Structural Basis of the Activation of Heterotrimeric Gs-protein by Isoproterenol-bound…
8DCR 2.6 Å, Cryo-EM structure of dobutamine-bound beta1-adrenergic receptor in complex with…
3ZPR 2.7 Å, Thermostabilised turkey beta1 adrenergic receptor with 4-methyl-2-(piperazin-1-yl)…
6H7L 2.7 Å, Activated turkey BETA1 adrenoceptor with bound partial agonist dobutamine and nanobody…

Browse structure collections

About this viewer

MolViewer shows 2VT4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.