2VZ6: PDB entry 2VZ6

Structure of human calcium calmodulin dependent protein kinase type II alpha (CAMK2A) in complex with Indirubin E804. Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Aug 2008.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 5,054
Mol. weight: 72.24 kDa
Ligands: PGO, FEF
Released: 26 Aug 2008

Explore 2VZ6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VZ6 contains 39 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	-3-0	4
β-strand	13-20	8	1
β-strand	26-32	7	1
α-helix	33-35	3
β-strand	37-45	9	1
α-helix	46-48	3
α-helix	51-66	16
β-strand	72	1	2
α-helix	73-74	2
β-strand	75-80	6	1
β-strand	84-90	7	1
β-strand	96	1	2
α-helix	97-102	6
α-helix	109-128	20
β-strand	131-132	2	3
α-helix	138-140	3
β-strand	141-143	3	2
α-helix	150-151	2
β-strand	152-154	3	2
β-strand	161-162	2	3
β-strand	169	1	4
α-helix	177-179	3
α-helix	182-185	4
β-strand	190	1	4
α-helix	193-208	16
α-helix	218-227	10
α-helix	236-239	4
α-helix	242-251	10
α-helix	260-261	2
α-helix	262-265	4
α-helix	269-272	4
α-helix	274-277	4
α-helix	284-298	15

Chain B: 19 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	-3-0	4
β-strand	13-21	9	5
β-strand	25-32	8	5
β-strand	37-45	9	5
α-helix	46-48	3
α-helix	51-55	5
α-helix	57-66	10
β-strand	72	1	6
α-helix	73-74	2
β-strand	75-80	6	5
β-strand	84-89	6	5
β-strand	95-96	2	6
α-helix	97-102	6
α-helix	109-128	20
β-strand	131-132	2	7
α-helix	138-140	3
β-strand	141-143	3	6
α-helix	150-151	2
β-strand	152-154	3	6
β-strand	161-162	2	7
β-strand	169	1	8
α-helix	177-179	3
α-helix	182-186	5
β-strand	190	1	8
α-helix	193-208	16
α-helix	218-227	10
α-helix	242-251	10
α-helix	260-261	2
α-helix	262-266	5
α-helix	269-272	4
α-helix	274-277	4
α-helix	284-299	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium calmodulin dependent protein kinase type II alpha chain	A, B	protein	313	HOMO SAPIENS	Q9UQM7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2VZ6_1 CALCIUM CALMODULIN DEPENDENT PROTEIN KINASE TYPE II ALPHA CHAIN (chains A, B)
MHHHHHHSSGVDLGTENLYFQSMYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKL
SARDHQKLEREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSE
ADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQA
WFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGA
YDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDC
LKKFNARRKLKGA

Ligands and cofactors

ID	Name	Formula	Copies
PGO	S-1,2-propanediol	C3 H8 O2	3
FEF	(2Z,3E)-2,3'-biindole-2',3(1H,1'H)-dione 3-{O-[(3R)-3,4-dihydroxybutyl]oxime}	C20 H19 N3 O4	2

Primary citation

Structure of the Camkiidelta/Calmodulin Complex Reveals the Molecular Mechanism of Camkii Kinase Activation. Rellos, P., Pike, A.C.W., Niesen, F.H. et al. PLoS Biol (2010) 8:426. DOI 10.1371/JOURNAL.PBIO.1000426 · PubMed

Other PDB entries of the same protein (UniProt Q9UQM7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X5G 1.85 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and LRRC7 inhibitory…
7UJR 1.95 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B
6OF8 2.1 Å, Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant…
7UJT 2.1 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D) in…
9EOY 2.1 Å, Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant…
6X5Q 2.14 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluA1
7REC 2.2 Å, Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant…
7UJQ 2.25 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B
7KL0 2.4 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)
7KL1 2.4 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)
6VZK 2.55 Å, Crystal structure of human CaMKII-alpha (CAMK2A)kinase domain
7KL2 2.56 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)

Browse structure collections

About this viewer

MolViewer shows 2VZ6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.