Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D). Determined by X-ray diffraction at 2.56 Å resolution. Released 23 Dec 2020.
Explore 7KL2 in 3D Show helices and sheets RCSB PDB PDBe
7KL2 contains 13 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-12 | 4 | |
| β-strand | 13-15 | 3 | 1 |
| β-strand | 20 | 1 | 1 |
| β-strand | 25-32 | 8 | 1 |
| β-strand | 38-45 | 8 | 1 |
| α-helix | 51-64 | 14 | |
| β-strand | 72 | 1 | 2 |
| α-helix | 73-74 | 2 | |
| β-strand | 75-81 | 7 | 1 |
| β-strand | 84-89 | 6 | 1 |
| β-strand | 96 | 1 | 2 |
| α-helix | 97-102 | 6 | |
| α-helix | 109-128 | 20 | |
| β-strand | 131-132 | 2 | 3 |
| α-helix | 138-140 | 3 | |
| β-strand | 141-143 | 3 | 2 |
| β-strand | 152-154 | 3 | 2 |
| β-strand | 161-162 | 2 | 3 |
| β-strand | 169 | 1 | 4 |
| β-strand | 175 | 1 | 5 |
| α-helix | 177-179 | 3 | |
| α-helix | 182-185 | 4 | |
| β-strand | 190 | 1 | 4 |
| α-helix | 194-208 | 15 | |
| α-helix | 218-226 | 9 | |
| α-helix | 236-239 | 4 | |
| α-helix | 242-251 | 10 | |
| α-helix | 262-267 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1304 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calcium/calmodulin-dependent protein kinase type II subunit alpha | A | protein | 268 | Homo sapiens | Q9UQM7 (AlphaFold model) |
| Glutamate receptor ionotropic, NMDA 2B | B | protein | 22 | Homo sapiens | Q13224 (AlphaFold model) |
>7KL2_1 Calcium/calmodulin-dependent protein kinase type II subunit alpha (chains A) TRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRL LKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHC HQMGVVHRNLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLR KDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYKQIKAGAYDFPSPEWDTVTPEAKD LINKMLTINPSKRITAAEALKHPWISHR
>7KL2_2 Glutamate receptor ionotropic, NMDA 2B (chains B) KAQKKNRNKLRRQHDYDTFVDL
Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D). Ozden, C., Stratton, M.M., Garman, S.C. To be published.
Other PDB entries of the same protein (UniProt Q9UQM7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7KL2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.