7REC: PDB entry 7REC

Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant human CaMKII alpha hub bound to 5-HDC. Determined by X-ray diffraction at 2.2 Å resolution. Released 21 Jul 2021.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 7
Atoms: 7,511
Mol. weight: 110.76 kDa
Ligands: 7ZV
Released: 21 Jul 2021

Explore 7REC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7REC contains 34 α-helices and 43 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	346-363	18
α-helix	366-372	7
β-strand	373-380	8	3
α-helix	382-384	3
α-helix	387	1
β-strand	388-390	3	3
α-helix	393-401	9
β-strand	411-422	12	3
β-strand	426-438	13	3
β-strand	444-458	15	3
β-strand	461-471	11	3

Chain B: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	346-362	17
α-helix	366-371	6
β-strand	373-380	8	4
α-helix	382-384	3
α-helix	387-388	2
β-strand	389-390	2	4
α-helix	393-400	8
α-helix	403-405	3
β-strand	411-421	11	4
β-strand	426-438	13	4
β-strand	444-458	15	4
β-strand	461-471	11	4

Chain C: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	346-363	18
α-helix	366-372	7
β-strand	373-380	8	5
α-helix	382-384	3
β-strand	389-390	2	5
α-helix	393-400	8
β-strand	410-421	12	5
β-strand	426-438	13	5
β-strand	444-458	15	5
β-strand	461-471	11	5

Chain D: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	343-362	20
α-helix	366-372	7
β-strand	373-380	8	2
α-helix	382-384	3
α-helix	387-388	2
β-strand	389-390	2	2
α-helix	393-400	8
β-strand	411-414	4	2
β-strand	418-421	4	2
β-strand	426-438	13	2
β-strand	444-458	15	2
β-strand	461-471	11	2
α-helix	473-474	2

Chain E: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	346-362	17
α-helix	366-372	7
β-strand	373-380	8	6
α-helix	382-384	3
β-strand	389-390	2	6
α-helix	393-401	9
β-strand	411-422	12	6
β-strand	426-438	13	6
β-strand	444-458	15	6
β-strand	461-471	11	6

Chain F: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	343-363	21
α-helix	366-372	7
β-strand	373-380	8	7
α-helix	382-384	3
α-helix	387-388	2
β-strand	389-390	2	7
α-helix	393-400	8
β-strand	411-421	11	7
β-strand	426-438	13	7
β-strand	444-458	15	7
β-strand	461-471	11	7

Chain G: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	344-362	19
α-helix	366-372	7
β-strand	373-380	8	1
α-helix	382-384	3
β-strand	389-390	2	1
α-helix	393-400	8
β-strand	411-421	11	1
β-strand	426-438	13	1
β-strand	444-458	15	1
β-strand	461-471	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium/calmodulin-dependent protein kinase type II subunit alpha	A, B, C, D, E, F, G	protein	135	Homo sapiens	Q9UQM7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>7REC_1 Calcium/calmodulin-dependent protein kinase type II subunit alpha (chains A, B, C, D, E, F, G)
GPHMVRKQEIIKVNQQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFE
NLWSRNSKPVHNTMLNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDG
KWQHVHMHRSGAPSV

Ligands and cofactors

ID	Name	Formula	Copies
7ZV	5-hydroxydiclofenac	C14 H11 Cl2 N O3	6

Water and common crystallization additives (NA) are not listed.

Primary citation

GHB analogs confer neuroprotection through specific interaction with the CaMKII alpha hub domain. Leurs, U., Klein, A.B., McSpadden, E.D. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2108079118 · PubMed

Other PDB entries of the same protein (UniProt Q9UQM7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X5G 1.85 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and LRRC7 inhibitory…
7UJR 1.95 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B
6OF8 2.1 Å, Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant…
7UJT 2.1 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D) in…
9EOY 2.1 Å, Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant…
6X5Q 2.14 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluA1
7UJQ 2.25 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B
2VZ6 2.3 Å, Structure of human calcium calmodulin dependent protein kinase type II alpha (CAMK2A) in…
7KL0 2.4 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)
7KL1 2.4 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)
6VZK 2.55 Å, Crystal structure of human CaMKII-alpha (CAMK2A)kinase domain
7KL2 2.56 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)

Browse structure collections

About this viewer

MolViewer shows 7REC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.