2VZI: Paxillin,Paxillin

Crystal structure of the C-terminal calponin homology domain of alpha- parvin in complex with paxillin LD4 motif. Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Oct 2008.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,413
Mol. weight: 18.08 kDa
Released: 28 Oct 2008

Explore 2VZI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VZI contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	249-256	8
α-helix	258-260	3
α-helix	261-276	16
α-helix	277-279	3
α-helix	294-304	11
α-helix	307-309	3
α-helix	310-312	3
α-helix	320-336	17
α-helix	339-342	4
α-helix	346-350	5
α-helix	354-367	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Paxillin,Paxillin	A	protein	20	Homo sapiens	P49023 (AlphaFold model)
Alpha-parvin	B	protein	131	Homo sapiens	Q9NVD7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2VZI_1 Paxillin,Paxillin (chains A)
ATRELDELMASLSDFKFMAQ

Sequence of entity 2 (B), FASTA

>2VZI_2 Alpha-parvin (chains B)
SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMG
LLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVL
YNLFTKYRNVE

Primary citation

Structural analysis of the interactions between paxillin LD motifs and alpha-parvin. Lorenz, S., Vakonakis, I., Lowe, E.D. et al. Structure (2008) 16:1521-1531. DOI 10.1016/j.str.2008.08.007 · PubMed

Other PDB entries of the same protein (UniProt P49023 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2O9V 1.63 Å, The second SH3 domain from Ponsin in complex with the paxillin proline rich region
2VZG 1.8 Å, Crystal structure of the C-terminal calponin homology domain of alpha- parvin in complex…
6PW8 1.95 Å, Hydrocarbon-Stapled Paxillin Peptide Bound to the Focal Adhesion Targeting (FAT) Domain…
4XH2 2.0 Å, Crystal structure of human paxillin LD4 motif in complex with Fab fragment
2VZD 2.1 Å, Crystal structure of the C-terminal calponin homology domain of alpha parvin in complex…
5UWH 2.26 Å, Crystal Structure of Paxillin NES Peptide in complex with CRM1-Ran-RanBP1
1OW6 2.35 Å, Paxillin LD4 motif bound to the Focal Adhesion Targeting (FAT) domain of the Focal…
3RQG 2.5 Å, Cerebral cavernous malformation 3 (CCM3) in complex with paxillin LD4
4XGZ 2.5 Å, Crystal structure of human paxillin LD2 motif in complex with Fab fragment
9QWO 2.54 Å, Vinculin tail bound to paxillin LD2
1OW7 2.6 Å, Paxillin LD4 motif bound to the Focal Adhesion Targeting (FAT) domain of the Focal…
6IUI 2.6 Å, Crystal structure of GIT1 PBD domain in complex with Paxillin LD4 motif

Browse structure collections

About this viewer

MolViewer shows 2VZI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.