Crystal structure of the C-terminal WD40 domain of human PALB2. Determined by X-ray diffraction at 1.9 Å resolution. Released 28 Jul 2009.
Explore 2W18 in 3D Show helices and sheets RCSB PDB PDBe
2W18 contains 2 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 855-861 | 7 | 1 |
| α-helix | 868 | 1 | |
| β-strand | 869-877 | 9 | 2 |
| β-strand | 884-891 | 8 | 2 |
| β-strand | 894-900 | 7 | 2 |
| β-strand | 905 | 1 | 1 |
| β-strand | 906-913 | 8 | 2 |
| α-helix | 918 | 1 | |
| β-strand | 919-922 | 4 | 3 |
| β-strand | 932-936 | 5 | 3 |
| β-strand | 941-947 | 7 | 3 |
| β-strand | 958-972 | 15 | 3 |
| β-strand | 976-981 | 6 | 3 |
| β-strand | 988-994 | 7 | 3 |
| β-strand | 1000-1006 | 7 | 3 |
| β-strand | 1013-1018 | 6 | 4 |
| β-strand | 1019-1020 | 2 | 5 |
| β-strand | 1025-1030 | 6 | 4 |
| β-strand | 1034-1039 | 6 | 4 |
| β-strand | 1045-1050 | 6 | 4 |
| β-strand | 1060-1066 | 7 | 5 |
| β-strand | 1069-1074 | 6 | 5 |
| β-strand | 1090-1096 | 7 | 5 |
| β-strand | 1101-1108 | 8 | 5 |
| β-strand | 1118-1124 | 7 | 6 |
| β-strand | 1127-1132 | 6 | 6 |
| β-strand | 1137-1141 | 5 | 6 |
| β-strand | 1147-1151 | 5 | 6 |
| β-strand | 1161-1164 | 4 | 1 |
| β-strand | 1170-1174 | 5 | 1 |
| β-strand | 1180-1185 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Partner and localizer of BRCA2 | A | protein | 356 | HOMO SAPIENS | Q86YC2 (AlphaFold model) |
>2W18_1 PARTNER AND LOCALIZER OF BRCA2 (chains A) GPHMSVEQTETAELPASDSINPGNLQLVSELKNPSGSCSVDVSAMFWERAGCKEPCIITA CEDVVSLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCS SDDESEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGGKENQFLMPPE ETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLL FIVLSHPCAKESESLRSPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHCAAA ILTSGTIAIWDLLLGQCTALLPPVSDQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS
Structural Basis for Recruitment of Brca2 by Palb2. Oliver, A.W., Swift, S., Lord, C.J. et al. EMBO Rep (2009) 10:990. DOI 10.1038/EMBOR.2009.126 · PubMed
Other PDB entries of the same protein (UniProt Q86YC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2W18 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.