Structure and Activity of Bypass Synthesis by Human DNA Polymerase Kappa Opposite the 7,8-Dihydro-8-oxodeoxyguanosine Adduct. Determined by X-ray diffraction at 3.71 Å resolution. Released 16 Jun 2009.
Explore 2W7P in 3D Show helices and sheets RCSB PDB PDBe
2W7P contains 38 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 37-40 | 4 | |
| α-helix | 48-72 | 25 | |
| α-helix | 78-95 | 18 | |
| β-strand | 103-108 | 6 | 1 |
| α-helix | 111-119 | 9 | |
| β-strand | 128-131 | 4 | 2 |
| β-strand | 136-138 | 3 | 2 |
| α-helix | 141-144 | 4 | |
| β-strand | 152 | 1 | 2 |
| α-helix | 154-160 | 7 | |
| β-strand | 165-167 | 3 | 2 |
| α-helix | 168-169 | 2 | |
| α-helix | 171-186 | 16 | |
| β-strand | 199-203 | 5 | 1 |
| α-helix | 205-209 | 5 | |
| α-helix | 217-219 | 3 | |
| β-strand | 220-222 | 3 | 3 |
| β-strand | 283-285 | 3 | 3 |
| α-helix | 290-302 | 13 | |
| β-strand | 309-314 | 6 | 1 |
| α-helix | 317-326 | 10 | |
| β-strand | 332-334 | 3 | 1 |
| α-helix | 339-346 | 8 | |
| β-strand | 350 | 1 | 4 |
| α-helix | 351-353 | 3 | |
| α-helix | 359-366 | 8 | |
| β-strand | 372 | 1 | 4 |
| α-helix | 373-377 | 5 | |
| α-helix | 380-383 | 4 | |
| α-helix | 389-400 | 12 | |
| β-strand | 416-425 | 10 | 5 |
| α-helix | 428-445 | 18 | |
| β-strand | 455-462 | 8 | 5 |
| β-strand | 469-473 | 5 | 5 |
| α-helix | 481-498 | 18 | |
| β-strand | 506-514 | 9 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 36-44 | 9 | |
| α-helix | 50-71 | 22 | |
| α-helix | 76-95 | 20 | |
| β-strand | 103-108 | 6 | 6 |
| α-helix | 112-118 | 7 | |
| β-strand | 130-131 | 2 | 7 |
| β-strand | 136-138 | 3 | 7 |
| α-helix | 141-144 | 4 | |
| α-helix | 154-160 | 7 | |
| β-strand | 167 | 1 | 7 |
| α-helix | 171-188 | 18 | |
| β-strand | 193-194 | 2 | 6 |
| β-strand | 199-202 | 4 | 6 |
| α-helix | 206-210 | 5 | |
| α-helix | 290-303 | 14 | |
| β-strand | 309-314 | 6 | 6 |
| α-helix | 317-324 | 8 | |
| β-strand | 332-334 | 3 | 6 |
| α-helix | 339-345 | 7 | |
| β-strand | 350 | 1 | 8 |
| β-strand | 354 | 1 | 9 |
| β-strand | 357 | 1 | 9 |
| α-helix | 359-366 | 8 | |
| β-strand | 372 | 1 | 8 |
| α-helix | 373-378 | 6 | |
| α-helix | 380-383 | 4 | |
| α-helix | 389-398 | 10 | |
| β-strand | 415-425 | 11 | 10 |
| α-helix | 428-446 | 19 | |
| α-helix | 447-449 | 3 | |
| β-strand | 455-461 | 7 | 10 |
| β-strand | 471-473 | 3 | 10 |
| α-helix | 481-498 | 18 | |
| β-strand | 506-514 | 9 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA polymerase kappa | A, B | protein | 508 | HOMO SAPIENS | Q9UBT6 (AlphaFold model) |
| 5'-d(*gp*gp*gp*gp*gp*ap*ap*gp*gp*ap*tp*tp*c)-3' | E, P | DNA | 13 | ||
| 5'-D(TP*CP*AP*CP*8OGP*GP*AP*AP*TP*CP*CP*TP* tp*cp*cp*cp*cp*c)-3' | F, T | DNA | 18 |
>2W7P_1 DNA POLYMERASE KAPPA (chains A, B) MGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQ LRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLST SNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLD EAYLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPLLFEESPS DVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFRIEQKTTLTASAGIAPNTM LAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTELYQ QRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQEL CSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDA DFPHPLRLRLMGVRISSFPNEEDRKHQQ
>2W7P_2 5'-D(*GP*GP*GP*GP*GP*AP*AP*GP*GP*AP*TP*TP*C)-3' (chains E, P) GGGGGAAGGATTC
>2W7P_3 5'-D(TP*CP*AP*CP*8OGP*GP*AP*AP*TP*CP*CP*TP* TP*CP*CP*CP*CP*C)-3' (chains F, T) TCACGGAATCCTTCCCCC
Structural and Functional Elucidation of the Mechanism Promoting Error-Prone Synthesis by Human DNA Polymerase Kappa Opposite the 7,8-Dihydro-8-Oxo-2'-Deoxyguanosine Adduct. Irimia, A., Eoff, R.L., Guengerich, F.P. et al. J Biol Chem (2009) 284:22467. DOI 10.1074/JBC.M109.003905 · PubMed
Other PDB entries of the same protein (UniProt Q9UBT6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2W7P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.