5W2A: Human DNA polymerase kappa

Name: PDB 5W2A: Structure of human DNA polymerase kappa in complex with Lucidin-derived DNA adduct and incoming dCMPNPP
Published: 2017-10-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: replication

Structure of human DNA polymerase kappa in complex with Lucidin-derived DNA adduct and incoming dCMPNPP. Determined by X-ray diffraction at 2.9 Å resolution. Released 18 Oct 2017.

Method: X-ray diffraction
Resolution: 2.9 Å
Organisms: Homo sapiens, unidentified
Chains: 6
Atoms: 7,735
Mol. weight: 142.28 kDa
Ligands: MG, 0KX
Released: 18 Oct 2017

Explore 5W2A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5W2A contains 44 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	33-44	12
α-helix	48-72	25
α-helix	76-96	21
β-strand	103-108	6	1
α-helix	111-118	8
α-helix	121-123	3
β-strand	128-131	4	2
β-strand	136-139	4	2
α-helix	141-144	4
α-helix	154-160	7
α-helix	164	1
β-strand	165-167	3	2
α-helix	171-188	18
β-strand	193-194	2	1
β-strand	199-203	5	1
α-helix	205-211	7
α-helix	216-219	4
β-strand	220-221	2	3
β-strand	284-285	2	3
α-helix	290-305	16
β-strand	309-314	6	1
α-helix	317-323	7
β-strand	334	1	1
α-helix	339-346	8
β-strand	350	1	4
α-helix	351-353	3
α-helix	359-366	8
β-strand	372	1	4
α-helix	373-378	6
α-helix	380-386	7
α-helix	389-399	11
β-strand	415-425	11	5
α-helix	428-449	22
β-strand	453-462	10	5
β-strand	467-478	12	5
α-helix	481-499	19
α-helix	503-504	2
β-strand	506-514	9	5

Chain B: 22 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	33-44	12
α-helix	48-72	25
α-helix	76-96	21
β-strand	103-108	6	6
α-helix	111-118	8
α-helix	121-123	3
β-strand	128-131	4	7
β-strand	136-139	4	7
α-helix	141-144	4
α-helix	154-160	7
α-helix	164	1
β-strand	165-167	3	7
α-helix	171-188	18
β-strand	193-194	2	6
β-strand	199-203	5	6
α-helix	205-211	7
α-helix	217-219	3
β-strand	220-221	2	8
β-strand	284-285	2	8
α-helix	290-305	16
β-strand	309-314	6	6
α-helix	317-324	8
β-strand	334	1	6
α-helix	339-346	8
β-strand	350	1	9
α-helix	351-353	3
α-helix	359-366	8
β-strand	372	1	9
α-helix	373-378	6
α-helix	380-386	7
α-helix	389-399	11
β-strand	415-425	11	10
α-helix	428-449	22
β-strand	453-462	10	10
β-strand	467-478	12	10
α-helix	481-499	19
α-helix	503-504	2
β-strand	506-514	9	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA polymerase kappa	A, B	protein	551	Homo sapiens	Q9UBT6 (AlphaFold model)
DNA (5'-d(pgpcpgpgpaptpcpap*g)-3')	C, P	DNA	9	unidentified
DNA (5'-d(aptpgp(ldg)pcptpgpaptpcpcpgp*c)-3')	D, T	DNA	13	unidentified

Sequence of entity 1 (A, B), FASTA

>5W2A_1 DNA polymerase kappa (chains A, B)
MSYYHHHHHHDYDIPTTENLYFQGAMDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEK
INKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQ
SRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGF
IAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEERQNWP
EDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQN
NPQILQNSVVFGTSAQEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQI
LPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYF
LHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKERLKGRT
VTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDADFPHPLRLRLMGVRISS
FPNEEDRKHQQ

Sequence of entity 2 (C, P), FASTA

>5W2A_2 DNA (5'-D(P*GP*CP*GP*GP*AP*TP*CP*AP*G)-3') (chains C, P)
GCGGATCAG

Sequence of entity 3 (D, T), FASTA

>5W2A_3 DNA (5'-D(*AP*TP*GP*(LDG)P*CP*TP*GP*AP*TP*CP*CP*GP*C)-3') (chains D, T)
ATGXCTGATCCGC

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
0KX	2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphory…	C9 H17 N4 O12 P3	2

Water and common crystallization additives (PGE, GOL) are not listed.

Primary citation

Mechanism of Error-Free DNA Replication Past Lucidin-Derived DNA Damage by Human DNA Polymerase kappa. Yockey, O.P., Jha, V., Ghodke, P.P. et al. Chem Res Toxicol (2017) 30:2023-2032. DOI 10.1021/acs.chemrestox.7b00227 · PubMed

Other PDB entries of the same protein (UniProt Q9UBT6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6CST 2.0 Å, Structure of human DNA polymerase kappa with DNA
1T94 2.4 Å, Crystal structure of the catalytic core of human DNA polymerase kappa
5W2C 2.5 Å, Structure of human DNA polymerase kappa in complex with Lucidin-derived DNA adduct and…
4U6P 2.59 Å, Structural mechanism of error-free bypass of major benzo[a]pyrene adduct by human…
4BA9 2.73 Å, The structural basis for the coordination of Y-family Translesion DNA Polymerases by Rev1
4U7C 2.8 Å, Structure of DNA polymerase kappa in complex with benzopyrene adducted DNA
6BRX 2.8 Å, Crystal Structure of Human DNA polymerase kappa in complex with DNA containing the major…
5T14 3.0 Å, DNA polymerase kappa extending beyond a bulky major benzo[a]pyrene adduct
2OH2 3.05 Å, Ternary Complex of Human DNA Polymerase
6BS1 3.15 Å, Crystal Structure of Human DNA polymerase kappa in complex with DNA containing the major…
2W7O 3.16 Å, Structure and Activity of Bypass Synthesis by Human DNA Polymerase Kappa Opposite the…
3IN5 3.2 Å, Structure of human DNA polymerase kappa inserting dATP opposite an 8-oxoG DNA lesion

Browse structure collections

About this viewer

MolViewer shows 5W2A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.