2W96: CDK4

Crystal Structure of CDK4 in complex with a D-type cyclin. Determined by X-ray diffraction at 2.3 Å resolution. Released 10 Mar 2009.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 4,306
Mol. weight: 65.67 kDa
Released: 10 Mar 2009

Explore 2W96 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2W96 contains 26 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	26-37	12
α-helix	44-47	4
α-helix	54-70	17
α-helix	77-89	13
α-helix	99-114	16
α-helix	118-120	3
α-helix	121-127	7
α-helix	134-147	14
α-helix	157-166	10
α-helix	172-190	19
α-helix	194-197	4
α-helix	200-218	19
α-helix	224-226	3
α-helix	229-237	9
α-helix	241-255	15

Chain B: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	1
β-strand	20-24	5	1
β-strand	31-40	10	1
β-strand	42	1	2
β-strand	48	1	2
α-helix	51-63	13
α-helix	64-66	3
β-strand	71	1	3
α-helix	72-73	2
β-strand	74-82	9	1
β-strand	86-94	9	1
β-strand	99	1	3
α-helix	100-105	6
α-helix	114-133	20
β-strand	146-148	3	3
β-strand	154-156	3	3
α-helix	162-169	8
α-helix	195-208	14
α-helix	219-230	12
α-helix	266-275	10
α-helix	280-282	3
α-helix	286-290	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
G1/S-specific cyclin-D1	A	protein	271	HOMO SAPIENS	P24385 (AlphaFold model)
Cell division protein kinase 4	B	protein	306	HOMO SAPIENS	P11802 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2W96_1 G1/S-SPECIFIC CYCLIN-D1 (chains A)
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAA

Sequence of entity 2 (B), FASTA

>2W96_2 CELL DIVISION PROTEIN KINASE 4 (chains B)
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRL
EAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQ
FLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALDPVVVTLWYRAP
EVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVS
LPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
HHHHHH

Primary citation

Crystal Structure of Human Cdk4 in Complex with a D-Type Cyclin. Day, P.J., Cleasby, A., Tickle, I.J. et al. Proc Natl Acad Sci U S A (2009) 106:4166. DOI 10.1073/PNAS.0809645106 · PubMed

Other PDB entries of the same protein (UniProt P24385 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CSK 2.25 Å, Crystal structure of CDK4 cyclin D1 in complex with atirmociclib
6P8E 2.3 Å, Crystal structure of CDK4 in complex with CyclinD1 and P27
2W9Z 2.45 Å, Crystal Structure of CDK4 in complex with a D-type cyclin
5VZU 2.7 Å, Crystal structure of the Skp1-FBXO31-cyclin D1 complex
2W99 2.8 Å, Crystal Structure of CDK4 in complex with a D-type cyclin
6P8G 2.8 Å, Crystal structure of CDK4 in complex with CyclinD1 and P27
2W9F 2.85 Å, Crystal Structure of CDK4 in complex with a D-type cyclin
6P8F 2.89 Å, Crystal structure of CDK4 in complex with CyclinD1 and P27
6P8H 3.19 Å, Crystal structure of CDK4 in complex with CyclinD1 and P21
9IVD 3.55 Å, Cryo-EM structure of CyclinD1 bound AMBRA1-DDB1

Browse structure collections

About this viewer

MolViewer shows 2W96 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.