6P8H: CDK4

Crystal structure of CDK4 in complex with CyclinD1 and P21. Determined by X-ray diffraction at 3.19 Å resolution. Released 25 Dec 2019.

Method: X-ray diffraction
Resolution: 3.19 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,388
Mol. weight: 71.48 kDa
Released: 25 Dec 2019

Explore 6P8H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6P8H contains 26 α-helices and 10 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	20-35	16
α-helix	54-70	17
α-helix	77-89	13
α-helix	99-114	16
α-helix	121-127	7
α-helix	134-147	14
α-helix	157-167	11
α-helix	172-191	20
α-helix	194-197	4
α-helix	200-212	13
α-helix	226-236	11
α-helix	241-260	20

Chain B: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	20-22	3	1
β-strand	32-39	8	1
β-strand	42	1	2
β-strand	45	1	2
α-helix	48-60	13
β-strand	68	1	3
β-strand	71-77	7	1
β-strand	84-91	8	1
β-strand	96	1	3
α-helix	97-102	6
α-helix	111-130	20
α-helix	140-142	3
β-strand	143-145	3	3
β-strand	151-153	3	3
α-helix	180-183	4
α-helix	192-206	15
α-helix	216-227	12
α-helix	236	1
α-helix	243-245	3
α-helix	254-256	3
α-helix	263-272	10
α-helix	281-282	2
α-helix	283-288	6

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	27-46	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
G1/S-specific cyclin-D1	A	protein	249	Homo sapiens	P24385 (AlphaFold model)
Cyclin-dependent kinase 4	B	protein	302	Homo sapiens	P11802 (AlphaFold model)
Cyclin-dependent kinase inhibitor 1	C	protein	80	Homo sapiens	P38936 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6P8H_1 G1/S-specific cyclin-D1 (chains A)
DANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVF
PLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELL
QMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISN
PPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESS
LRQAQQNMD

Sequence of entity 2 (B), FASTA

>6P8H_2 Cyclin-dependent kinase 4 (chains B)
GEFATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLR
RLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLM
RQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYR
APEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRD
VSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGN
PE

Sequence of entity 3 (C), FASTA

>6P8H_3 Cyclin-dependent kinase inhibitor 1 (chains C)
GEFRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAW
ERVRGLGLPKLYLPTGPRRG

Primary citation

p27 allosterically activates cyclin-dependent kinase 4 and antagonizes palbociclib inhibition. Guiley, K.Z., Stevenson, J.W., Lou, K. et al. Science (2019) 366. DOI 10.1126/science.aaw2106 · PubMed

Other PDB entries of the same protein (UniProt P24385 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CSK 2.25 Å, Crystal structure of CDK4 cyclin D1 in complex with atirmociclib
2W96 2.3 Å, Crystal Structure of CDK4 in complex with a D-type cyclin
6P8E 2.3 Å, Crystal structure of CDK4 in complex with CyclinD1 and P27
2W9Z 2.45 Å, Crystal Structure of CDK4 in complex with a D-type cyclin
5VZU 2.7 Å, Crystal structure of the Skp1-FBXO31-cyclin D1 complex
2W99 2.8 Å, Crystal Structure of CDK4 in complex with a D-type cyclin
6P8G 2.8 Å, Crystal structure of CDK4 in complex with CyclinD1 and P27
2W9F 2.85 Å, Crystal Structure of CDK4 in complex with a D-type cyclin
6P8F 2.89 Å, Crystal structure of CDK4 in complex with CyclinD1 and P27
9IVD 3.55 Å, Cryo-EM structure of CyclinD1 bound AMBRA1-DDB1

Browse structure collections

About this viewer

MolViewer shows 6P8H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.