Crystal structure of the N-terminal signalling domain of human Dhh with calcium. Determined by X-ray diffraction at 1.95 Å resolution. Released 30 Jun 2009.
Explore 2WFR in 3D Show helices and sheets RCSB PDB PDBe
2WFR contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 41-44 | 4 | |
| β-strand | 48-49 | 2 | 1 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-79 | 2 | 2 |
| β-strand | 85-87 | 3 | 1 |
| α-helix | 95-97 | 3 | |
| β-strand | 98-99 | 2 | 2 |
| α-helix | 101-117 | 17 | |
| β-strand | 123-127 | 5 | 1 |
| α-helix | 140-143 | 4 | |
| β-strand | 146-151 | 6 | 1 |
| α-helix | 156-158 | 3 | |
| α-helix | 159-168 | 10 | |
| β-strand | 173-178 | 6 | 1 |
| β-strand | 181-185 | 5 | 1 |
| α-helix | 192-195 | 4 | |
| α-helix | 197-200 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Desert hedgehog protein N-product | A | protein | 165 | HOMO SAPIENS | O43323 (AlphaFold model) |
>2WFR_1 DESERT HEDGEHOG PROTEIN N-PRODUCT (chains A) QLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRL MTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNK YGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVKLEHHHHHH
Water and common crystallization additives (SO4) are not listed.
Structural Insights Into Hedgehog Ligand Sequestration by the Human Hedgehog-Interacting Protein Hip. Bishop, B., Aricescu, A.R., Harlos, K. et al. Nat Struct Mol Biol (2009) 16:698. DOI 10.1038/NSMB.1607 · PubMed
Other PDB entries of the same protein (UniProt O43323 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2WFR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.