2WFR: Desert hedgehog protein N-product

Crystal structure of the N-terminal signalling domain of human Dhh with calcium. Determined by X-ray diffraction at 1.95 Å resolution. Released 30 Jun 2009.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,434
Mol. weight: 19.19 kDa
Ligands: CA, ZN
Released: 30 Jun 2009

Explore 2WFR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WFR contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	41-44	4
β-strand	48-49	2	1
α-helix	74-76	3
β-strand	78-79	2	2
β-strand	85-87	3	1
α-helix	95-97	3
β-strand	98-99	2	2
α-helix	101-117	17
β-strand	123-127	5	1
α-helix	140-143	4
β-strand	146-151	6	1
α-helix	156-158	3
α-helix	159-168	10
β-strand	173-178	6	1
β-strand	181-185	5	1
α-helix	192-195	4
α-helix	197-200	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Desert hedgehog protein N-product	A	protein	165	HOMO SAPIENS	O43323 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2WFR_1 DESERT HEDGEHOG PROTEIN N-PRODUCT (chains A)
QLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRL
MTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNK
YGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVKLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2
ZN	Zinc ion	Zn	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structural Insights Into Hedgehog Ligand Sequestration by the Human Hedgehog-Interacting Protein Hip. Bishop, B., Aricescu, A.R., Harlos, K. et al. Nat Struct Mol Biol (2009) 16:698. DOI 10.1038/NSMB.1607 · PubMed

Other PDB entries of the same protein (UniProt O43323 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WFQ 1.85 Å, Crystal structure of the N-terminal signalling domain of human Dhh without calcium
3N1G 1.9 Å, Crystal structure of DhhN bound to BOCFn3
2WG3 2.6 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…
3N1Q 2.89 Å, Crystal Structure of DhhN bound to CDOFn3

Browse structure collections

About this viewer

MolViewer shows 2WFR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.