2WFX: Sonic hedgehog protein N-product

Crystal structure of the complex between human hedgehog-interacting protein HIP and Sonic Hedgehog in the presence of calcium. Determined by X-ray diffraction at 3.2 Å resolution. Released 30 Jun 2009.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: MUS MUSCULUS, HOMO SAPIENS
Chains: 2
Atoms: 4,472
Mol. weight: 68.59 kDa
Ligands: CA, ZN
Released: 30 Jun 2009

Explore 2WFX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WFX contains 13 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	42-44	3
β-strand	48-49	2	1
α-helix	72-76	5
β-strand	78	1	2
β-strand	85-87	3	1
β-strand	99	1	2
α-helix	101-117	17
β-strand	123-127	5	1
β-strand	146-151	6	1
α-helix	156-158	3
α-helix	159-169	11
β-strand	173-178	6	1
β-strand	181-185	5	1

Chain B: 8 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	216	1	3
β-strand	218-226	9	4
β-strand	229-233	5	4
β-strand	243-246	4	4
β-strand	250-252	3	4
β-strand	254	1	5
β-strand	260	1	5
β-strand	266-267	2	4
β-strand	284-289	6	6
α-helix	293-296	4
β-strand	298-305	8	6
β-strand	317-326	10	6
β-strand	334-347	14	6
β-strand	356-359	4	7
β-strand	365-368	4	7
α-helix	376-381	6
β-strand	391-395	5	7
β-strand	396	1	8
β-strand	407	1	8
β-strand	424-427	4	7
β-strand	432	1	9
β-strand	434	1	10
α-helix	435	1
β-strand	436-438	3	11
β-strand	446-452	7	11
β-strand	454	1	9
β-strand	464-469	6	11
α-helix	477-480	4
β-strand	481-482	2	11
β-strand	493-496	4	10
β-strand	509-512	4	10
β-strand	518-522	5	10
β-strand	531-535	5	10
β-strand	536	1	3
β-strand	551-556	6	4
β-strand	562-566	5	4
β-strand	577-583	7	4
α-helix	592-594	3
α-helix	607-611	5
β-strand	615-617	3	12
β-strand	623-625	3	12
α-helix	626	1
β-strand	629-630	2	13
β-strand	636-637	2	13
α-helix	642-643	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sonic hedgehog protein N-product	A	protein	152	MUS MUSCULUS	Q62226 (AlphaFold model)
Hedgehog-interacting protein	B	protein	457	HOMO SAPIENS	Q96QV1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2WFX_1 SONIC HEDGEHOG PROTEIN N-PRODUCT (chains A)
LTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLM
TQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKY
GMLARLAVEAGFDWVYYESKAHIHCSVKAENS

Sequence of entity 2 (B), FASTA

>2WFX_2 HEDGEHOG-INTERACTING PROTEIN (chains B)
HNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQ
SGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQ
VDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVL
RLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCS
DSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGD
RNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQ
THNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDF
CRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3
ZN	Zinc ion	Zn	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Structural Insights Into Hedgehog Ligand Sequestration by the Human Hedgehog-Interacting Protein Hip. Bishop, B., Aricescu, A.R., Harlos, K. et al. Nat Struct Mol Biol (2009) 16:698. DOI 10.1038/NSMB.1607 · PubMed

Other PDB entries of the same protein (UniProt Q62226 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1VHH 1.7 Å, A potential catalytic site within the amino-terminal signalling domain of sonic hedgehog
3D1M 1.7 Å, Crystal Structure of Sonic Hedgehog Bound to the third FNIII domain of CDO
4C4M 1.74 Å, Crystal structure of the Sonic Hedgehog-chondroitin-4-sulphate complex
3N1R 2.13 Å, Crystal Structure of ShhN
4C4N 2.36 Å, Crystal structure of the Sonic Hedgehog-heparin complex
7RPK 2.7 Å, Cryo-EM structure of murine Dispatched in complex with Sonic hedgehog
2WG4 3.15 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…

Browse structure collections

About this viewer

MolViewer shows 2WFX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.