Crystal structure of the complex between human hedgehog-interacting protein HIP and sonic hedgehog without calcium. Determined by X-ray diffraction at 3.15 Å resolution. Released 30 Jun 2009.
Explore 2WG4 in 3D Show helices and sheets RCSB PDB PDBe
2WG4 contains 15 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 41-44 | 4 | |
| β-strand | 48-49 | 2 | 1 |
| α-helix | 72-76 | 5 | |
| β-strand | 78-79 | 2 | 2 |
| β-strand | 85-87 | 3 | 1 |
| β-strand | 98-99 | 2 | 2 |
| α-helix | 101-117 | 17 | |
| β-strand | 123-127 | 5 | 1 |
| α-helix | 140-143 | 4 | |
| β-strand | 146-151 | 6 | 1 |
| α-helix | 159-168 | 10 | |
| β-strand | 173-175 | 3 | 1 |
| β-strand | 182-185 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 218-223 | 6 | 3 |
| β-strand | 229-233 | 5 | 3 |
| β-strand | 242-246 | 5 | 3 |
| β-strand | 250-254 | 5 | 3 |
| α-helix | 259 | 1 | |
| β-strand | 260 | 1 | 3 |
| α-helix | 261 | 1 | |
| β-strand | 266-267 | 2 | 3 |
| β-strand | 284-289 | 6 | 4 |
| α-helix | 293-296 | 4 | |
| β-strand | 298-305 | 8 | 4 |
| β-strand | 317-326 | 10 | 4 |
| β-strand | 334-347 | 14 | 4 |
| β-strand | 354-359 | 6 | 5 |
| α-helix | 364 | 1 | |
| β-strand | 365-369 | 5 | 5 |
| α-helix | 376-381 | 6 | |
| β-strand | 391-395 | 5 | 5 |
| β-strand | 396 | 1 | 6 |
| β-strand | 407 | 1 | 6 |
| β-strand | 424-427 | 4 | 5 |
| β-strand | 434 | 1 | 7 |
| α-helix | 435 | 1 | |
| β-strand | 436-438 | 3 | 8 |
| β-strand | 448-454 | 7 | 8 |
| β-strand | 462-468 | 7 | 8 |
| α-helix | 477-480 | 4 | |
| β-strand | 481-483 | 3 | 8 |
| β-strand | 493-496 | 4 | 7 |
| β-strand | 509-512 | 4 | 7 |
| β-strand | 518-522 | 5 | 7 |
| β-strand | 531-535 | 5 | 7 |
| β-strand | 551-556 | 6 | 3 |
| β-strand | 562-566 | 5 | 3 |
| β-strand | 578-583 | 6 | 3 |
| α-helix | 607-610 | 4 | |
| β-strand | 615-617 | 3 | 9 |
| β-strand | 623-625 | 3 | 9 |
| α-helix | 626 | 1 | |
| β-strand | 629-630 | 2 | 10 |
| β-strand | 636-637 | 2 | 10 |
| α-helix | 642-643 | 2 | |
| β-strand | 651 | 1 | 11 |
| β-strand | 654 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sonic hedgehog protein N-product | A | protein | 155 | MUS MUSCULUS | Q62226 (AlphaFold model) |
| Hedgehog-interacting protein | B | protein | 457 | HOMO SAPIENS | Q96QV1 (AlphaFold model) |
>2WG4_1 SONIC HEDGEHOG PROTEIN N-PRODUCT (chains A) LTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLM TQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKY GMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAA
>2WG4_2 HEDGEHOG-INTERACTING PROTEIN (chains B) HNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQ SGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQ VDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVL RLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCS DSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGD RNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQ THNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDF CRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVD
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (NA) are not listed.
Structural Insights Into Hedgehog Ligand Sequestration by the Human Hedgehog-Interacting Protein Hip. Bishop, B., Aricescu, A.R., Harlos, K. et al. Nat Struct Mol Biol (2009) 16:698. DOI 10.1038/NSMB.1607 · PubMed
Other PDB entries of the same protein (UniProt Q62226 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2WG4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.