2WNJ: Aplysia achbp
Crystal structure of aplysia achbp in complex with dmxba. Determined by X-ray diffraction at 1.8 Å resolution. Released 1 Sept 2009.
- Method
- X-ray diffraction
- Resolution
- 1.8 Å
- Organism
- APLYSIA CALIFORNICA
- Chains
- 5
- Atoms
- 10,037
- Mol. weight
- 132.35 kDa
- Ligands
- ZY7, NAG
- Released
- 1 Sept 2009
Explore 2WNJ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2WNJ contains 23 α-helices and 79 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 6 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1-10 | 10 | |
| α-helix | 11-16 | 6 | |
| α-helix | 18-19 | 2 | |
| β-strand | 24 | 1 | 1 |
| β-strand | 27 | 1 | 1 |
| β-strand | 29-44 | 16 | 2 |
| β-strand | 49-66 | 18 | 2 |
| α-helix | 69-71 | 3 | |
| β-strand | 77-81 | 5 | 2 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 3 |
| β-strand | 95 | 1 | 2 |
| β-strand | 100-101 | 2 | 2 |
| β-strand | 106-110 | 5 | 2 |
| β-strand | 112-117 | 6 | 2 |
| β-strand | 120-126 | 7 | 2 |
| β-strand | 138-146 | 9 | 3 |
| β-strand | 154-157 | 4 | 2 |
| β-strand | 162 | 1 | 3 |
| α-helix | 163 | 1 | |
| β-strand | 164 | 1 | 2 |
| β-strand | 174-186 | 13 | 3 |
| β-strand | 195-206 | 12 | 3 |
Chain B: 4 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -2-14 | 17 | |
| α-helix | 18-20 | 3 | |
| β-strand | 24 | 1 | 4 |
| β-strand | 27 | 1 | 4 |
| β-strand | 29-44 | 16 | 5 |
| β-strand | 49-66 | 18 | 5 |
| α-helix | 69-71 | 3 | |
| β-strand | 77-81 | 5 | 5 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 6 |
| β-strand | 95 | 1 | 5 |
| β-strand | 100-101 | 2 | 5 |
| β-strand | 106-110 | 5 | 5 |
| β-strand | 112-117 | 6 | 5 |
| β-strand | 120-126 | 7 | 5 |
| β-strand | 138-146 | 9 | 6 |
| β-strand | 154-157 | 4 | 5 |
| β-strand | 162 | 1 | 6 |
| β-strand | 164 | 1 | 5 |
| β-strand | 174-186 | 13 | 6 |
| β-strand | 195-206 | 12 | 6 |
Chain C: 4 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -5-14 | 20 | |
| α-helix | 18-20 | 3 | |
| β-strand | 29-44 | 16 | 7 |
| β-strand | 49-66 | 18 | 7 |
| α-helix | 69-72 | 4 | |
| β-strand | 77-81 | 5 | 7 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 8 |
| β-strand | 95 | 1 | 7 |
| β-strand | 100-101 | 2 | 7 |
| β-strand | 106-110 | 5 | 7 |
| β-strand | 112-117 | 6 | 7 |
| β-strand | 120-126 | 7 | 7 |
| β-strand | 138-146 | 9 | 8 |
| β-strand | 154-157 | 4 | 7 |
| β-strand | 162 | 1 | 8 |
| β-strand | 164 | 1 | 7 |
| β-strand | 174-186 | 13 | 8 |
| β-strand | 195-206 | 12 | 8 |
Chain D: 6 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -1-10 | 12 | |
| α-helix | 11-15 | 5 | |
| α-helix | 18-20 | 3 | |
| β-strand | 29-44 | 16 | 9 |
| β-strand | 49-66 | 18 | 9 |
| α-helix | 69-71 | 3 | |
| β-strand | 77-81 | 5 | 9 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 10 |
| β-strand | 95 | 1 | 9 |
| β-strand | 100-101 | 2 | 9 |
| β-strand | 106-110 | 5 | 9 |
| β-strand | 112-117 | 6 | 9 |
| β-strand | 120-126 | 7 | 9 |
| β-strand | 138-146 | 9 | 10 |
| β-strand | 154-157 | 4 | 9 |
| β-strand | 162 | 1 | 10 |
| α-helix | 163 | 1 | |
| β-strand | 164 | 1 | 9 |
| β-strand | 174-186 | 13 | 10 |
| β-strand | 195-206 | 12 | 10 |
Chain E: 3 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -7-14 | 22 | |
| β-strand | 29-44 | 16 | 11 |
| β-strand | 49-66 | 18 | 11 |
| α-helix | 69-71 | 3 | |
| β-strand | 77-81 | 5 | 11 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 12 |
| β-strand | 95 | 1 | 11 |
| β-strand | 100-101 | 2 | 11 |
| β-strand | 106-110 | 5 | 11 |
| β-strand | 112-117 | 6 | 11 |
| β-strand | 120-126 | 7 | 11 |
| β-strand | 138-146 | 9 | 12 |
| β-strand | 154-157 | 4 | 11 |
| β-strand | 162 | 1 | 12 |
| β-strand | 164 | 1 | 11 |
| β-strand | 174-186 | 13 | 12 |
| β-strand | 195-206 | 12 | 12 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Soluble acetylcholine receptor | A, B, C, D, E | protein | 228 | APLYSIA CALIFORNICA | Q8WSF8 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E), FASTA
>2WNJ_1 SOLUBLE ACETYLCHOLINE RECEPTOR (chains A, B, C, D, E)
DYKDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVD
LVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTH
DGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYAS
SKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERRAGNGFFRNLFD
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZY7 | (3E)-3-[(2,4-dimethoxyphenyl)methylidene]-3,4,5,6-tetrahydro-2,3'-bipyridine | C19 H20 N2 O2 | 5 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Primary citation
Structural Determinants for Interaction of Partial Agonists with Acetylcholine Binding Protein and Neuronal Alpha7 Nicotinic Acetylcholine Receptor. Hibbs, R.E., Sulzenbacher, G., Shi, J. et al. EMBO J (2009) 28:3040. DOI 10.1038/EMBOJ.2009.227 · PubMed
Other PDB entries of the same protein (UniProt Q8WSF8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6T9R 1.72 Å, Aplysia californica AChBP in complex with a cytisine derivative
- 2WN9 1.75 Å, Crystal structure of Aplysia ACHBP in complex with 4-0H-DMXBA
- 2PGZ 1.76 Å, Crystal structure of Cocaine bound to an ACh-Binding Protein
- 8QTL 1.85 Å, Aplysia californica acetylcholine-binding protein in complex with Spiroimine (-)-4 S
- 2Y7Y 1.9 Å, Aplysia californica achbp in apo state
- 4XHE 1.9 Å, Crystal Structure of A-AChBP in complex with pinnatoxin A
- 4ZK4 1.9 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
- 2XYS 1.91 Å, Crystal structure of Aplysia californica AChBP in complex with strychnine
- 5TVC 1.93 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
- 3C84 1.94 Å, Crystal structure of a complex of AChBP from aplysia californica and the neonicotinoid…
- 2YMD 1.96 Å, Crystal structure of a mutant binding protein (5HTBP-AChBP) in complex with serotonin…
- 4WV9 2.0 Å, Crystal structure of acetylcholine binding protein (AChBP) from Aplysia Californica in…
Browse structure collections
About this viewer
MolViewer shows 2WNJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.