2X25: Free acetyl-CypA orthorhombic form

Free acetyl-CypA orthorhombic form. Determined by X-ray diffraction at 1.2 Å resolution. Released 23 Mar 2010.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,744
Mol. weight: 18.64 kDa
Released: 23 Mar 2010

Explore 2X25 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2X25 contains 4 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	0-1	2
β-strand	5-12	8	1
β-strand	15-24	10	1
α-helix	30-41	12
β-strand	52-57	6	1
β-strand	61-64	4	1
β-strand	77	1	2
β-strand	80	1	2
β-strand	83	1	3
β-strand	97-100	4	1
β-strand	108	1	3
β-strand	112-115	4	1
α-helix	120-122	3
β-strand	128-134	7	1
α-helix	136-143	8
β-strand	156-163	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase a	B	protein	169	HOMO SAPIENS	P62937 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>2X25_1 PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A (chains B)
HHHHHVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRI
IPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICT
AKTKWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Primary citation

Acetylation Regulates Cyclophilin a Catalysis, Immunosuppression and HIV Isomerization. Lammers, M., Neumann, H., Chin, J.W. et al. Nat Chem Biol (2010) 6:331. DOI 10.1038/NCHEMBIO.342 · PubMed

Other PDB entries of the same protein (UniProt P62937 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9E3S 1.08 Å, Tricomplex of RMC-9945, KRAS G12N, and CypA
9BG4 1.14 Å, Tri-complex of Compound-2, KRAS G12V, and CypA
4N1M 1.15 Å, Structure of Cyclophilin A in complex with GlyPro.
5F66 1.15 Å, High-resolution isotropic multiconformer synchrotron model of CypA at 273 K
9GHY 1.15 Å, Cyclophilin A in complex with Sanglifehrin A analogue (2R,3S,7S,10S,E)-10-(3-aminopropyl)…
6GJL 1.16 Å, Cyclophilin A complexed with tri-vector ligand 10.
6GS6 1.16 Å, Cyclophilin A single mutant D66A in complex with an inhibitor.
4YUO 1.2 Å, High-resolution multiconformer synchrotron model of CypA at 273 K
7UXM 1.2 Å, Structure of PPIA in complex with FP29092, a Helicon Polypeptide
8TBG 1.2 Å, Tricomplex of RMC-7977, HRAS WT, and CypA
9BFV 1.2 Å, Tri-complex of Compound-23, KRAS G12C, and CypA
9BFW 1.2 Å, Tri-complex of Compound-4, KRAS G12C, and CypA

Browse structure collections

About this viewer

MolViewer shows 2X25 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.