2X6S: Integrase
Human foamy virus integrase - catalytic core. Magnesium-bound structure. Determined by X-ray diffraction at 2.29 Å resolution. Released 11 Aug 2010.
- Method
- X-ray diffraction
- Resolution
- 2.29 Å
- Organism
- HUMAN SPUMARETROVIRUS
- Chains
- 6
- Atoms
- 9,015
- Mol. weight
- 135.61 kDa
- Ligands
- MG
- Released
- 11 Aug 2010
Explore 2X6S in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2X6S contains 51 α-helices and 46 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 9 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 124-130 | 7 | 1 |
| β-strand | 136 | 1 | 2 |
| β-strand | 139 | 1 | 2 |
| β-strand | 141-147 | 7 | 1 |
| β-strand | 153-158 | 6 | 1 |
| α-helix | 163-173 | 11 | |
| β-strand | 181-184 | 4 | 1 |
| α-helix | 188-191 | 4 | |
| α-helix | 193-201 | 9 | |
| α-helix | 204 | 1 | |
| β-strand | 205-208 | 4 | 1 |
| α-helix | 219-236 | 18 | |
| α-helix | 242-254 | 13 | |
| α-helix | 265-270 | 6 | |
| α-helix | 275-276 | 2 | |
| α-helix | 289-301 | 13 | |
Chain B: 8 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 124-130 | 7 | 3 |
| β-strand | 136 | 1 | 4 |
| β-strand | 139 | 1 | 4 |
| β-strand | 141-147 | 7 | 3 |
| β-strand | 153-158 | 6 | 3 |
| α-helix | 163-173 | 11 | |
| β-strand | 181-184 | 4 | 3 |
| α-helix | 188-191 | 4 | |
| β-strand | 192 | 1 | 5 |
| α-helix | 193-202 | 10 | |
| α-helix | 204 | 1 | |
| β-strand | 205-208 | 4 | 3 |
| α-helix | 219-236 | 18 | |
| α-helix | 242-254 | 13 | |
| α-helix | 265-270 | 6 | |
| α-helix | 289-301 | 13 | |
Chain C: 8 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 124-130 | 7 | 6 |
| β-strand | 136 | 1 | 7 |
| β-strand | 139 | 1 | 7 |
| β-strand | 141-147 | 7 | 6 |
| β-strand | 153-158 | 6 | 6 |
| α-helix | 163-173 | 11 | |
| β-strand | 181-184 | 4 | 6 |
| α-helix | 188-191 | 4 | |
| α-helix | 193-202 | 10 | |
| α-helix | 204 | 1 | |
| β-strand | 205-208 | 4 | 6 |
| α-helix | 223-236 | 14 | |
| α-helix | 242-254 | 13 | |
| α-helix | 265-270 | 6 | |
| β-strand | 274 | 1 | 5 |
| α-helix | 289-301 | 13 | |
Chain D: 9 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 124-130 | 7 | 8 |
| β-strand | 136 | 1 | 9 |
| β-strand | 139 | 1 | 9 |
| β-strand | 141-147 | 7 | 8 |
| β-strand | 153-158 | 6 | 8 |
| α-helix | 163-173 | 11 | |
| β-strand | 181-184 | 4 | 8 |
| α-helix | 188-191 | 4 | |
| α-helix | 193-201 | 9 | |
| α-helix | 204 | 1 | |
| β-strand | 205-208 | 4 | 8 |
| α-helix | 221-236 | 16 | |
| α-helix | 242-253 | 12 | |
| β-strand | 258 | 1 | 10 |
| β-strand | 263 | 1 | 10 |
| α-helix | 265-270 | 6 | |
| α-helix | 275-276 | 2 | |
| α-helix | 289-301 | 13 | |
Chain E: 9 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 124-130 | 7 | 11 |
| β-strand | 136 | 1 | 12 |
| β-strand | 139 | 1 | 12 |
| β-strand | 141-147 | 7 | 11 |
| β-strand | 153-158 | 6 | 11 |
| α-helix | 163-173 | 11 | |
| β-strand | 181-184 | 4 | 11 |
| α-helix | 188-191 | 4 | |
| α-helix | 193-202 | 10 | |
| α-helix | 204 | 1 | |
| β-strand | 205-208 | 4 | 11 |
| α-helix | 220-236 | 17 | |
| α-helix | 242-254 | 13 | |
| α-helix | 265-270 | 6 | |
| α-helix | 275-276 | 2 | |
| α-helix | 289-301 | 13 | |
Chain F: 8 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 124-130 | 7 | 13 |
| β-strand | 136 | 1 | 14 |
| β-strand | 139 | 1 | 14 |
| β-strand | 141-147 | 7 | 13 |
| β-strand | 153-158 | 6 | 13 |
| α-helix | 163-173 | 11 | |
| β-strand | 181-184 | 4 | 13 |
| α-helix | 188-191 | 4 | |
| α-helix | 193-201 | 9 | |
| α-helix | 204 | 1 | |
| β-strand | 205-208 | 4 | 13 |
| α-helix | 220-236 | 17 | |
| α-helix | 242-254 | 13 | |
| α-helix | 265-269 | 5 | |
| α-helix | 289-301 | 13 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Integrase | A, B, C, D, E, F | protein | 200 | HUMAN SPUMARETROVIRUS | P14350 |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>2X6S_1 INTEGRASE (chains A, B, C, D, E, F)
GPILRPDRPQKPFDKFFMDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKS
LNVLTSIAIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDMKR
LLTKLLVGRPTKWYDLLPVVQLAMNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTRE
EELSLLQEIRTSLYHPSTPP
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 6 |
Primary citation
Structural Studies of the Catalytic Core of the Primate Foamy Virus (Pfv-1) Integrase. Rety, S., Rezabkova, L., Dubanchet, B. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2010) 66:881. DOI 10.1107/S1744309110022852 · PubMed
Other PDB entries of the same protein (UniProt P14350), best resolution first:
- 2X78 2.0 Å, Human foamy virus integrase - catalytic core.
- 3OYM 2.02 Å, Crystal structure of the PFV N224H mutant intasome bound to manganese
- 2X6N 2.06 Å, Human foamy virus integrase - catalytic core. Manganese-bound structure.
- 3DLR 2.2 Å, Crystal structure of the catalytic core domain from PFV integrase
- 2X74 2.34 Å, Human foamy virus integrase - catalytic core.
- 4BE2 2.38 Å, PFV intasome with inhibitor XZ-259
- 3S3M 2.49 Å, Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with magnesium…
- 3S3N 2.49 Å, Crystal structure of the Prototype Foamy Virus (PFV) S217H mutant intasome in complex…
- 3OYF 2.51 Å, Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with magnesium…
- 4BDY 2.52 Å, PFV intasome with inhibitor XZ-89
- 4E7I 2.53 Å, PFV intasome freeze-trapped prior to 3'-processing, Mn-bound form (UI-Mn)
- 3OYB 2.54 Å, Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with magnesium…
Browse structure collections
About this viewer
MolViewer shows 2X6S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.