2X9M: Hendra virus attachment glycoprotein

Hendra virus attachment glycoprotein. Determined by X-ray diffraction at 2.9 Å resolution. Released 21 Apr 2010.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: HENDRA VIRUS
Chains: 4
Atoms: 13,464
Mol. weight: 191.04 kDa
Ligands: NAG
Released: 21 Apr 2010

Explore 2X9M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2X9M contains 30 α-helices and 139 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	201-202	2	1
α-helix	203-204	2
β-strand	205	1	2
β-strand	206-208	3	3
β-strand	215-225	11	2
β-strand	228-237	10	2
β-strand	244-257	14	2
β-strand	263-271	9	2
α-helix	276-278	3
β-strand	279-287	9	4
β-strand	290-297	8	4
β-strand	314-320	7	4
β-strand	332-337	6	4
β-strand	339-341	3	5
β-strand	347-350	4	5
β-strand	354	1	4
β-strand	356-358	3	5
β-strand	361-371	11	5
α-helix	372-374	3
α-helix	379-381	3
α-helix	394-397	4
β-strand	407-417	11	5
β-strand	425-430	6	5
β-strand	431	1	6
α-helix	432	1
β-strand	442-447	6	7
β-strand	450-455	6	7
β-strand	465-471	7	7
β-strand	475	1	6
β-strand	476-479	4	7
β-strand	509	1	1
β-strand	511-515	5	8
β-strand	520-526	7	8
β-strand	533	1	9
β-strand	535-541	7	8
β-strand	544-550	7	8
β-strand	557	1	9
β-strand	561-568	8	1
β-strand	571-578	8	1
β-strand	587-588	2	2
β-strand	591-596	6	1
α-helix	597-598	2

Chain B: 8 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	201-202	2	10
α-helix	203-204	2
β-strand	205	1	11
β-strand	206-208	3	12
β-strand	215-225	11	11
β-strand	228-237	10	11
α-helix	243	1
β-strand	244-257	14	11
β-strand	263-271	9	11
α-helix	276-278	3
β-strand	279-286	8	13
β-strand	290-297	8	13
β-strand	314-320	7	13
β-strand	332-337	6	13
β-strand	339-341	3	14
β-strand	347-350	4	14
β-strand	354	1	13
β-strand	356-358	3	14
β-strand	361-371	11	14
α-helix	372-374	3
α-helix	379-381	3
α-helix	394-397	4
β-strand	407-417	11	14
β-strand	425-430	6	14
β-strand	431	1	15
α-helix	432	1
β-strand	442-447	6	16
β-strand	450-455	6	16
β-strand	465-471	7	16
β-strand	475	1	15
β-strand	476-479	4	16
β-strand	509	1	10
β-strand	511-515	5	17
β-strand	520-526	7	17
β-strand	533	1	18
β-strand	535-541	7	17
β-strand	544-550	7	17
β-strand	557	1	18
β-strand	558-568	11	10
β-strand	571-580	10	10
β-strand	587-588	2	11
β-strand	591-596	6	10
α-helix	597-598	2

Chain C: 8 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	201-202	2	19
α-helix	203-204	2
β-strand	205	1	20
β-strand	206-208	3	3
α-helix	209-210	2
β-strand	215-225	11	20
β-strand	228-237	10	20
β-strand	244-257	14	20
β-strand	263-271	9	20
α-helix	276-278	3
β-strand	279-287	9	21
β-strand	290-297	8	21
β-strand	314-320	7	21
β-strand	332-337	6	21
β-strand	339-341	3	22
β-strand	347-350	4	22
β-strand	354	1	21
β-strand	356-358	3	22
β-strand	361-371	11	22
α-helix	372-374	3
α-helix	379-381	3
α-helix	394-397	4
β-strand	407-417	11	22
β-strand	425-430	6	22
β-strand	431	1	23
α-helix	432	1
β-strand	442-447	6	24
β-strand	450-455	6	24
β-strand	465-471	7	24
β-strand	475	1	23
β-strand	476-479	4	24
β-strand	509	1	19
β-strand	511-515	5	25
β-strand	520-526	7	25
β-strand	533	1	26
β-strand	535-541	7	25
β-strand	544-550	7	25
β-strand	557	1	26
β-strand	558-567	10	19
β-strand	572-580	9	19
β-strand	587-588	2	20
β-strand	591-596	6	19
α-helix	597-598	2

Chain D: 7 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	201-202	2	27
α-helix	203-204	2
β-strand	205	1	28
β-strand	206-208	3	12
α-helix	209-210	2
β-strand	215-225	11	28
β-strand	228-237	10	28
β-strand	244-257	14	28
β-strand	263-271	9	28
β-strand	279-287	9	29
β-strand	290-297	8	29
β-strand	314-320	7	29
β-strand	332-337	6	29
β-strand	340-341	2	30
β-strand	347-350	4	30
β-strand	354	1	29
β-strand	356-358	3	30
β-strand	361-371	11	30
α-helix	372-374	3
α-helix	379-381	3
α-helix	394-397	4
β-strand	407-417	11	30
β-strand	426-430	5	30
β-strand	431	1	31
α-helix	432	1
β-strand	442-447	6	32
β-strand	450-455	6	32
β-strand	465-471	7	32
β-strand	475	1	31
β-strand	476-479	4	32
β-strand	509	1	27
β-strand	511-515	5	33
β-strand	520-526	7	33
β-strand	533	1	27
β-strand	535-541	7	33
β-strand	544-550	7	33
β-strand	557-567	11	27
β-strand	572-581	10	27
β-strand	587-588	2	28
β-strand	591-596	6	27
α-helix	597-598	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycoprotein G	A, B, C, D	protein	420	HENDRA VIRUS	O89343 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2X9M_1 GLYCOPROTEIN G (chains A, B, C, D)
PNQICLQKTTSTILKPRLISYTLPINTREGVCITDPLLAVDNGFFAYSHLEKIGSCTRGI
AKQRIIGVGEVLDRGDKVPSMFMTNVWTPPNPSTIHHCSSTYHEDFYYTLCAVSHVGDPI
LNSTSWTESLSLIRLAVRPKSDSGDYNQKYIAITKVERGKYDKVMPYGPSGIKQGDTLYF
PAVGFLPRTEFQYNDSNCPIIHCKYSKAENCRLSMGVNSKSHYILRSGLLKYNLSLGGDI
ILQFIEIADNRLTIGSPSKIYNSLGQPVFYQASYSWDTMIKLGDVDTVDPLRVQWRNNSV
ISRPGQSQCPRFNVCPEVCWEGTYNDAFLIDRLNWVSAGVYLNSNQTAENPVFAVFKDNE
ILYQVPLAEDDTNAQKTITDCFLLENVIWCISLVEIYDTGDSVIRPKLFAVKIPAQCSES

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	10

Primary citation

Dimeric Architecture of the Hendra Virus Attachment Glycoprotein: Evidence for a Conserved Mode of Assembly. Bowden, T.A., Crispin, M., Harvey, D.J. et al. J Virol (2010) 84:6208. DOI 10.1128/JVI.00317-10 · PubMed

Other PDB entries of the same protein (UniProt O89343 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VY4 2.0 Å, Crystal structure of Hendra receptor binding protein head domain in complex with human…
6PD4 2.2 Å, Crystal Structure of Hendra Virus Attachment G Glycoprotein
6VY6 2.6 Å, Crystal structure of Hendra receptor binding protein head domain in complex with human…
6CMG 2.7 Å, Crystal Structure of the Hendra Virus Attachment G Glycoprotein Bound to a Potent…
6PDL 2.7 Å, Crystal Structure of Hendra Virus Attachment G Glycoprotein in Complex with Receptor…
6CMI 2.72 Å, Crystal Structure of the Hendra Virus Attachment G Glycoprotein Bound to a Potent…
7SYY 2.74 Å, Hendra virus G protein head domain in complex with cross-neutralizing murine antibody…
7SYZ 2.86 Å, Hendra virus G protein head domain in complex with cross-neutralizing murine antibody…
8VF1 3.0 Å, Crystal Structure of the Hendra Virus Attachment G glycoprotein (HeV-G)
8JR3 3.22 Å, Crystal structure of Hendra Virus attachment(G) glycoprotein mutant S586N in complex…
2VSK 3.3 Å, Hendra virus attachment glycoprotein in complex with human cell surface receptor ephrinB2
8JR5 3.3 Å, Crystal structure of Hendra Virus attachment(G) glycoprotein mutant S586N

Browse structure collections

About this viewer

MolViewer shows 2X9M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.