2XWB: Complement C3b

Crystal Structure of Complement C3b in complex with Factors B and D. Determined by X-ray diffraction at 3.49 Å resolution. Released 12 Jan 2011.

Method: X-ray diffraction
Resolution: 3.49 Å
Organism: HOMO SAPIENS
Chains: 8
Atoms: 39,285
Mol. weight: 566.82 kDa
Ligands: MG, NAG
Released: 12 Jan 2011

Explore 2XWB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XWB contains 168 α-helices and 360 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 54 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	5-9	5	2
β-strand	11-13	3	3
β-strand	17-23	7	2
β-strand	25	1	1
β-strand	32-40	9	3
β-strand	48-53	6	3
α-helix	56-58	3
β-strand	61-67	7	2
β-strand	82-90	9	3
β-strand	93-102	10	3
β-strand	107-112	6	4
β-strand	116-117	2	5
β-strand	122-130	9	4
β-strand	136	1	4
β-strand	140-146	7	5
β-strand	152-159	8	5
β-strand	166-172	7	4
α-helix	173-174	2
β-strand	180-188	9	5
β-strand	196-202	7	5
β-strand	210-216	7	6
β-strand	229-237	9	6
α-helix	241	1
β-strand	242	1	6
α-helix	243	1
β-strand	245-254	10	7
β-strand	259-271	13	7
β-strand	272	1	6
β-strand	275-280	6	6
α-helix	282-288	7
β-strand	298	1	8
β-strand	300	1	8
β-strand	301-310	10	7
β-strand	316-325	10	7
β-strand	332-334	3	9
β-strand	341-342	2	10
β-strand	348-355	8	9
β-strand	361	1	9
β-strand	367-369	3	11
β-strand	384-389	6	9
α-helix	397	1
β-strand	398-404	7	11
α-helix	411-413	3
β-strand	416-421	6	11
β-strand	422-423	2	10
β-strand	433-438	6	12
β-strand	443	1	13
β-strand	448-456	9	12
α-helix	462-464	3
β-strand	467-474	8	14
β-strand	477-485	9	14
β-strand	492-498	7	12
α-helix	499	1
β-strand	506-515	10	14
β-strand	523-532	10	14
β-strand	533	1	13
β-strand	542-545	4	15
β-strand	558-565	8	15
β-strand	570-572	3	16
β-strand	575-577	3	17
α-helix	578-581	4
α-helix	591-599	9
α-helix	613-620	8
β-strand	622-626	5	2
β-strand	631	1	2
α-helix	632-634	3

Chain B: 36 helices, 57 β-strands

Element	Residues	Length	Sheet
β-strand	742	1	18
β-strand	748-749	2	17
β-strand	753-755	3	16
β-strand	761	1	19
β-strand	764	1	19
β-strand	765-772	8	15
β-strand	779-782	4	17
β-strand	785-787	3	16
β-strand	793-795	3	16
α-helix	796-798	3
β-strand	799-802	4	17
β-strand	807-812	6	20
β-strand	816-818	3	21
β-strand	823-831	9	20
β-strand	838-844	7	18
α-helix	845-846	2
β-strand	861	1	18
β-strand	864-866	3	18
β-strand	870-878	9	20
β-strand	886-894	9	18
β-strand	900-907	8	18
β-strand	908-910	3	21
α-helix	911	1
β-strand	914-921	8	22
β-strand	924-925	2	22
β-strand	932	1	23
β-strand	935-939	5	23
α-helix	941-943	3
β-strand	948	1	22
α-helix	949	1
β-strand	955-962	8	22
β-strand	966	1	24
α-helix	970-974	5
α-helix	975-978	4
α-helix	991-1009	19
α-helix	1012-1015	4
α-helix	1020-1035	16
β-strand	1038	1	25
β-strand	1044	1	25
α-helix	1051-1052	2
α-helix	1054-1064	11
α-helix	1067-1069	3
α-helix	1075-1083	9
α-helix	1084-1088	5
α-helix	1109-1111	3
α-helix	1117-1130	14
α-helix	1143-1154	12
α-helix	1164-1175	12
α-helix	1183-1190	8
β-strand	1193	1	26
β-strand	1197	1	26
α-helix	1205-1221	17
α-helix	1227-1235	9
α-helix	1247-1260	14
β-strand	1267	1	24
β-strand	1271-1277	7	23
β-strand	1285-1290	6	23
β-strand	1298-1302	5	22
β-strand	1309-1315	7	23
β-strand	1318-1328	11	22
β-strand	1339-1346	8	27
β-strand	1362-1370	9	27
β-strand	1376	1	28
β-strand	1379-1384	6	29
β-strand	1390-1391	2	27
α-helix	1393-1401	9
β-strand	1405-1406	2	29
α-helix	1409-1412	4
α-helix	1415-1417	3
β-strand	1421-1423	3	29
β-strand	1425-1426	2	29
β-strand	1429	1	28
β-strand	1437-1442	6	27
α-helix	1450-1452	3
β-strand	1453-1459	7	29
β-strand	1467-1471	5	29
α-helix	1476-1478	3
α-helix	1479-1481	3
β-strand	1482-1485	4	30
β-strand	1488-1491	4	30
α-helix	1507-1514	8
β-strand	1519-1532	14	31
β-strand	1537-1548	12	31
β-strand	1559-1563	5	31
α-helix	1566-1568	3
α-helix	1569-1572	4
β-strand	1579-1585	7	31
α-helix	1586-1588	3
β-strand	1598-1599	2	31
β-strand	1605-1608	4	31
α-helix	1612-1614	3
α-helix	1621-1632	12
α-helix	1633-1637	5

Chain C: 15 helices, 53 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	32
β-strand	5-9	5	33
β-strand	11-13	3	34
β-strand	17-23	7	33
β-strand	25	1	32
β-strand	32-40	9	34
β-strand	48-53	6	34
α-helix	56-58	3
β-strand	61-67	7	33
β-strand	82-90	9	34
β-strand	93-102	10	34
β-strand	107-112	6	35
β-strand	116-117	2	36
β-strand	122-130	9	35
β-strand	136	1	35
β-strand	140-146	7	36
β-strand	152-159	8	36
β-strand	166-172	7	35
α-helix	173-174	2
β-strand	180-188	9	36
β-strand	196-202	7	36
β-strand	210-216	7	37
β-strand	229-237	9	37
α-helix	241	1
β-strand	242	1	37
α-helix	243	1
β-strand	245-254	10	38
β-strand	259-271	13	38
β-strand	272	1	37
β-strand	275-280	6	37
α-helix	282-288	7
α-helix	295-297	3
β-strand	298	1	39
β-strand	300	1	39
β-strand	301-310	10	38
β-strand	316-325	10	38
β-strand	332-334	3	40
β-strand	341-342	2	41
β-strand	348-355	8	40
β-strand	361	1	40
β-strand	367-369	3	42
β-strand	384-389	6	40
α-helix	397	1
β-strand	398-404	7	42
α-helix	411-413	3
β-strand	416-421	6	42
β-strand	422-423	2	41
β-strand	433-438	6	43
β-strand	443	1	44
β-strand	448-456	9	43
α-helix	462-464	3
β-strand	467-474	8	45
β-strand	477-485	9	45
β-strand	492-498	7	43
α-helix	499	1
β-strand	506-515	10	45
β-strand	523-532	10	45
β-strand	533	1	44
β-strand	542-545	4	46
β-strand	558-565	8	46
β-strand	570-577	8	47
α-helix	578-581	4
α-helix	591-599	9
α-helix	613-620	8
β-strand	622-626	5	33
β-strand	631	1	33
α-helix	632-634	3
α-helix	640-641	2

Chain D: 34 helices, 52 β-strands

Element	Residues	Length	Sheet
β-strand	742	1	48
β-strand	748-749	2	47
β-strand	753-755	3	47
β-strand	765-772	8	46
β-strand	779-787	9	47
β-strand	793-795	3	47
β-strand	799-802	4	47
β-strand	807-812	6	49
β-strand	816-818	3	48
β-strand	823-831	9	49
β-strand	838-844	7	48
α-helix	845-846	2
β-strand	860-866	7	48
β-strand	870-878	9	49
β-strand	884-894	11	48
β-strand	900-910	11	48
α-helix	911	1
β-strand	914-921	8	50
β-strand	924-925	2	50
β-strand	932	1	51
β-strand	935-939	5	51
α-helix	941-943	3
β-strand	948	1	50
α-helix	949	1
β-strand	954-962	9	50
β-strand	966	1	52
α-helix	970-974	5
α-helix	975-978	4
α-helix	991-1009	19
α-helix	1012-1015	4
α-helix	1020-1035	16
β-strand	1038	1	53
β-strand	1044	1	53
α-helix	1051-1052	2
α-helix	1054-1064	11
α-helix	1067-1069	3
α-helix	1075-1083	9
α-helix	1084-1088	5
α-helix	1109-1111	3
α-helix	1117-1130	14
α-helix	1143-1154	12
α-helix	1164-1175	12
α-helix	1183-1190	8
β-strand	1193	1	54
β-strand	1197	1	54
α-helix	1205-1221	17
α-helix	1227-1235	9
α-helix	1247-1260	14
β-strand	1267	1	52
β-strand	1271-1277	7	51
β-strand	1285-1290	6	51
β-strand	1298-1302	5	50
β-strand	1309-1315	7	51
β-strand	1318-1328	11	50
β-strand	1339-1346	8	55
β-strand	1362-1370	9	55
β-strand	1376	1	56
β-strand	1379-1384	6	57
β-strand	1390-1391	2	55
α-helix	1393-1401	9
β-strand	1405-1406	2	57
α-helix	1409-1412	4
α-helix	1415-1417	3
β-strand	1421-1423	3	57
β-strand	1425-1426	2	57
β-strand	1429	1	56
β-strand	1437-1442	6	55
α-helix	1450-1452	3
β-strand	1453-1459	7	57
β-strand	1467-1471	5	57
α-helix	1476-1478	3
β-strand	1482-1485	4	58
β-strand	1488-1491	4	58
α-helix	1507-1514	8
β-strand	1519-1532	14	59
β-strand	1537-1548	12	59
β-strand	1559-1564	6	59
α-helix	1566-1568	3
α-helix	1569-1572	4
β-strand	1579-1585	7	59
α-helix	1586-1588	3
β-strand	1598-1599	2	59
β-strand	1605-1608	4	59
α-helix	1612-1614	3
α-helix	1621-1632	12
α-helix	1633-1637	5

Chain F: 29 helices, 52 β-strands

Element	Residues	Length	Sheet
α-helix	11-13	3
β-strand	19-20	2	60
β-strand	22	1	60
β-strand	23-27	5	61
β-strand	32-36	5	61
α-helix	37-38	2
β-strand	41-44	4	60
β-strand	48-50	3	61
β-strand	51	1	62
β-strand	57	1	62
α-helix	58-59	2
β-strand	61	1	63
β-strand	67	1	63
β-strand	71-75	5	60
β-strand	78	1	64
β-strand	87-90	4	65
β-strand	96	1	64
β-strand	101-106	6	65
β-strand	111-113	3	66
β-strand	117-119	3	65
β-strand	120	1	67
β-strand	126	1	67
α-helix	129-131	3
β-strand	132-134	3	66
β-strand	149-152	4	68
β-strand	161-166	6	68
α-helix	167	1
β-strand	171-173	3	69
β-strand	177-179	3	68
β-strand	180-181	2	70
β-strand	185-186	2	70
β-strand	192-194	3	69
β-strand	200	1	71
α-helix	202-213	12
α-helix	215-218	4
β-strand	244-251	8	72
α-helix	257-276	20
α-helix	282	1
β-strand	283-289	7	72
β-strand	293-297	5	72
α-helix	307-316	10
α-helix	319-322	4
α-helix	330-341	12
β-strand	356-363	8	72
α-helix	374-383	10
α-helix	395-397	3
β-strand	398-404	7	72
α-helix	411-417	7
β-strand	427-429	3	72
β-strand	430	1	71
α-helix	435-442	8
α-helix	449-451	3
β-strand	471-478	8	73
β-strand	482-490	9	73
β-strand	496-498	3	73
α-helix	509-511	3
β-strand	512-516	5	73
β-strand	523-530	8	73
β-strand	553-557	5	73
β-strand	571	1	74
β-strand	575	1	75
α-helix	576-581	6
α-helix	590-597	8
β-strand	602-610	9	74
β-strand	615-623	9	74
α-helix	628-632	5
α-helix	633-637	5
α-helix	641-643	3
α-helix	647-649	3
β-strand	655-658	4	74
α-helix	666-669	4
α-helix	671-673	3
β-strand	677-682	6	74
β-strand	685-695	11	74
β-strand	700	1	76
β-strand	705	1	76
β-strand	715-719	5	74
α-helix	720-722	3
α-helix	724-730	7
α-helix	732-734	3
β-strand	738	1	75

Chain H: 29 helices, 52 β-strands

Element	Residues	Length	Sheet
α-helix	11-13	3
β-strand	19-20	2	77
β-strand	22	1	77
β-strand	23-27	5	78
β-strand	32-36	5	78
α-helix	37-38	2
β-strand	41-44	4	77
β-strand	48-50	3	78
β-strand	51	1	79
β-strand	57	1	79
α-helix	58-59	2
β-strand	61	1	80
β-strand	67	1	80
β-strand	71-75	5	77
β-strand	78	1	81
β-strand	87-90	4	82
β-strand	96	1	81
β-strand	101-106	6	82
β-strand	111-113	3	83
β-strand	117-119	3	82
β-strand	120	1	84
β-strand	126	1	84
α-helix	129-131	3
β-strand	132-134	3	83
β-strand	149-152	4	85
β-strand	161-166	6	85
α-helix	167	1
β-strand	171-173	3	86
β-strand	177-179	3	85
β-strand	180-181	2	87
β-strand	185-186	2	87
β-strand	192-194	3	86
β-strand	200	1	88
α-helix	202-213	12
α-helix	215-218	4
β-strand	244-251	8	89
α-helix	257-276	20
α-helix	282	1
β-strand	283-289	7	89
β-strand	293-297	5	89
α-helix	307-316	10
α-helix	319-322	4
α-helix	330-340	11
β-strand	356-363	8	89
α-helix	374-383	10
α-helix	395-397	3
β-strand	398-404	7	89
α-helix	411-417	7
β-strand	427-429	3	89
β-strand	430	1	88
α-helix	435-442	8
α-helix	449-451	3
β-strand	471-478	8	90
β-strand	482-490	9	90
β-strand	495-498	4	90
α-helix	509-511	3
β-strand	512-516	5	90
β-strand	523-530	8	90
β-strand	553-557	5	90
β-strand	571	1	91
β-strand	575	1	92
α-helix	576-581	6
α-helix	590-597	8
β-strand	602-610	9	91
β-strand	615-623	9	91
α-helix	628-632	5
α-helix	633-637	5
α-helix	641-643	3
α-helix	647-649	3
β-strand	655-658	4	91
α-helix	666-669	4
α-helix	671-673	3
β-strand	677-682	6	91
β-strand	685-695	11	91
β-strand	700	1	93
β-strand	705	1	93
β-strand	715-719	5	91
α-helix	720-722	3
α-helix	724-730	7
α-helix	732-734	3
β-strand	738	1	92

Chain I: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	94
β-strand	5-6	2	95
α-helix	7-8	2
β-strand	15-20	6	96
β-strand	24-30	7	96
β-strand	35-38	4	96
α-helix	40-43	4
β-strand	51-55	5	96
β-strand	59	1	97
β-strand	68-77	10	96
β-strand	91-95	5	96
β-strand	102	1	98
β-strand	105	1	98
β-strand	110	1	95
α-helix	116-118	3
β-strand	122-127	6	95
β-strand	140	1	97
β-strand	142-147	6	95
α-helix	151-154	4
β-strand	168-171	4	95
β-strand	177	1	94
β-strand	186-188	3	95
β-strand	193-197	5	95
β-strand	211-215	5	95
α-helix	216-219	4
α-helix	220-226	7

Chain J: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	99
β-strand	5-6	2	100
α-helix	7-8	2
β-strand	15-20	6	101
β-strand	24-30	7	101
β-strand	35-38	4	101
α-helix	40-44	5
β-strand	51-55	5	101
β-strand	59	1	102
β-strand	68-77	10	101
β-strand	91-95	5	101
β-strand	102	1	103
β-strand	105	1	103
β-strand	110	1	100
α-helix	116-118	3
β-strand	122-127	6	100
β-strand	140	1	102
β-strand	142-147	6	100
α-helix	151-154	4
β-strand	168-171	4	100
β-strand	177	1	99
β-strand	186-188	3	100
β-strand	193-197	5	100
β-strand	211-215	5	100
α-helix	216-219	4
α-helix	220-226	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C3B beta chain	A, C	protein	642	HOMO SAPIENS	P01024 (AlphaFold model)
Complement C3B alpha' chain	B, D	protein	912	HOMO SAPIENS	P01024 (AlphaFold model)
Complement factor B	F, H	protein	732	HOMO SAPIENS	P00751 (AlphaFold model)
Complement factor D	I, J	protein	228	HOMO SAPIENS	P00746 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2XWB_1 COMPLEMENT C3B BETA CHAIN (chains A, C)
SPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNH
MGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPG
STVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMG
QWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYG
KKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEVVLSRKVLLDGVQNPRAEDLVGK
SLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPGMPFDLMVFVTNPDGS
PAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQ
ALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRLLK
AGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCVGS
LVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDKGVFVLNKKNKLTQSKIWDVVEK
ADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAELQCPQ

Sequence of entity 2 (B, D), FASTA

>2XWB_2 COMPLEMENT C3B ALPHA' CHAIN (chains B, D)
DEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSD
KKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPA
FCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKV
VPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTESETRILLQGTPVAQMT
EDAVDAERLKHLIVTPSGCGEENMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKK
GYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEK
QKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITK
AGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVE
ATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQE
LNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAK
AKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGF
APDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVEL
IQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEE
RLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCR
EALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGA
FTESMVVFGCPN

Sequence of entity 3 (F, H), FASTA

>2XWB_3 COMPLEMENT FACTOR B (chains F, H)
GSCSLEGVEIKGGSFRLLQEGQALEYVCPSGFYPYPVQTRTCRSTGSWSTLKTQDQKTVR
KAECRAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQ
TAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGT
EPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLV
LDGSGSIGASDFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEADSSNADW
VTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRHVIILMTDGLHNM
GGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINALASKKDNEQHVFK
VKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGA
VVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYD
YDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVS
EEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNT
CRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKE
KLQDEDLGFLAA

Sequence of entity 4 (I, J), FASTA

>2XWB_4 COMPLEMENT FACTOR D (chains I, J)
ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSL
SQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPG
TLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCK
GDAGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation. Forneris, F., Ricklin, D., Wu, J. et al. Science (2010) 330:1816. DOI 10.1126/SCIENCE.1195821 · PubMed

Other PDB entries of the same protein (UniProt P01024 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WY7 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
2WY8 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
7UE9 1.75 Å, Structure of anti-C3d Fab(3d8b) in complex with C3d
1C3D 1.8 Å, X-ray crystal structure of C3D: a C3 fragment and ligand for complement receptor 2
6RMT 2.0 Å, Crystal structure of disulphide-linked human C3d dimer
7BAG 2.0 Å, C3b in complex with CP40
1GHQ 2.04 Å, CR2-C3D complex structure
3D5R 2.1 Å, Crystal Structure of Efb-C (N138A) / C3d Complex
3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
4I6O 2.14 Å, Crystal structure of chemically synthesized human anaphylatoxin C3a
4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
2GOX 2.2 Å, Crystal structure of Efb-C / C3d Complex

Browse structure collections

About this viewer

MolViewer shows 2XWB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.