Crystal Structure of Nurf55 in complex with a H4 peptide. Determined by X-ray diffraction at 1.75 Å resolution. Released 4 May 2011.
Explore 2XYI in 3D Show helices and sheets RCSB PDB PDBe
2XYI contains 10 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-35 | 24 | |
| β-strand | 36-43 | 8 | 1 |
| β-strand | 51-53 | 3 | 2 |
| β-strand | 58-59 | 2 | 2 |
| α-helix | 60 | 1 | |
| β-strand | 66-73 | 8 | 2 |
| β-strand | 81-90 | 10 | 2 |
| β-strand | 119-127 | 9 | 2 |
| β-strand | 133-137 | 5 | 3 |
| β-strand | 140-147 | 8 | 3 |
| β-strand | 153-157 | 5 | 3 |
| α-helix | 158-160 | 3 | |
| α-helix | 165-166 | 2 | |
| β-strand | 175-178 | 4 | 3 |
| β-strand | 187-189 | 3 | 4 |
| β-strand | 196-200 | 5 | 4 |
| β-strand | 206-210 | 5 | 4 |
| α-helix | 214-215 | 2 | |
| β-strand | 216 | 1 | 3 |
| α-helix | 217-219 | 3 | |
| β-strand | 220-222 | 3 | 3 |
| β-strand | 225-227 | 3 | 4 |
| β-strand | 234-239 | 6 | 5 |
| β-strand | 246-251 | 6 | 5 |
| β-strand | 255-260 | 6 | 5 |
| β-strand | 271-274 | 4 | 5 |
| β-strand | 280-285 | 6 | 6 |
| β-strand | 292-297 | 6 | 6 |
| β-strand | 301-306 | 6 | 6 |
| β-strand | 315-318 | 4 | 6 |
| β-strand | 324-329 | 6 | 7 |
| β-strand | 336-341 | 6 | 7 |
| β-strand | 346-350 | 5 | 7 |
| α-helix | 351-353 | 3 | |
| α-helix | 360-365 | 6 | |
| β-strand | 370-374 | 5 | 7 |
| β-strand | 381-386 | 6 | 1 |
| β-strand | 393-398 | 6 | 1 |
| β-strand | 402-408 | 7 | 1 |
| α-helix | 410-413 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 31-39 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Probable histone-binding protein CAF1 | A | protein | 430 | DROSOPHILA MELANOGASTER | Q24572 (AlphaFold model) |
| Histone H4 | B | protein | 20 | DROSOPHILA MELANOGASTER | P84040 (AlphaFold model) |
>2XYI_1 PROBABLE HISTONE-BINDING PROTEIN CAF1 (chains A) MVDRSDNAAESFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQ DGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIE IEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGH QKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWH LLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADK TVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQST EDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPEI PASELETNTA
>2XYI_2 HISTONE H4 (chains B) IQGITKPAIRRLARRGGVKR
Chromatin-Modifying Complex Component Nurf55/P55 Associates with Histones H3, H4 and Polycomb Repressive Complex 2 Subunit Su(Z)12 Through Partially Overlapping Binding Sites. Nowak, A.J., Alfieri, C., Stirnimann, C.U. et al. J Biol Chem (2011) 286:23388. DOI 10.1074/JBC.M110.207407 · PubMed
Other PDB entries of the same protein (UniProt Q24572 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2XYI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.