2XYT: Aplysia californica AChBP

Name: PDB 2XYT: Crystal structure of Aplysia californica AChBP in complex with d- tubocurarine
Published: 2011-03-23
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: receptor

Crystal structure of Aplysia californica AChBP in complex with d- tubocurarine. Determined by X-ray diffraction at 2.05 Å resolution. Released 23 Mar 2011.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: APLYSIA CALIFORNICA
Chains: 10
Atoms: 18,839
Mol. weight: 249.94 kDa
Ligands: TC9
Released: 23 Mar 2011

Explore 2XYT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XYT contains 46 α-helices and 162 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
β-strand	22	1	1
β-strand	25	1	1
β-strand	27-42	16	2
β-strand	47-64	18	2
α-helix	67-69	3
β-strand	75-79	5	2
α-helix	80-82	3
β-strand	88-90	3	3
β-strand	93	1	2
α-helix	96-97	2
β-strand	98-99	2	2
β-strand	104-108	5	2
β-strand	110-115	6	2
β-strand	118-124	7	2
β-strand	136-144	9	3
β-strand	152-155	4	2
β-strand	160	1	3
β-strand	162	1	2
β-strand	172-184	13	3
β-strand	193-204	12	3

Chain B: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
α-helix	16-18	3
β-strand	27-42	16	4
β-strand	47-59	13	4
α-helix	61-63	3
α-helix	67-69	3
β-strand	75-79	5	4
α-helix	80-82	3
β-strand	88-90	3	5
β-strand	93	1	4
β-strand	98-99	2	4
β-strand	104-108	5	4
β-strand	112-115	4	4
β-strand	118-124	7	4
β-strand	136-144	9	5
β-strand	152-155	4	4
β-strand	160	1	5
β-strand	162	1	4
β-strand	172-185	14	5
β-strand	193-204	12	5

Chain C: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
α-helix	16-18	3
β-strand	27-42	16	6
β-strand	47-64	18	6
α-helix	67-69	3
β-strand	75-79	5	6
α-helix	80-82	3
β-strand	88-90	3	7
β-strand	93	1	6
α-helix	96-97	2
β-strand	98-99	2	6
β-strand	104-108	5	6
β-strand	110-115	6	6
β-strand	118-124	7	6
β-strand	136-144	9	7
β-strand	152-155	4	6
β-strand	160	1	7
β-strand	162	1	6
β-strand	172-184	13	7
β-strand	193-204	12	7

Chain D: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
β-strand	22	1	8
β-strand	25	1	8
β-strand	27-42	16	9
β-strand	47-64	18	9
α-helix	67-69	3
β-strand	75-79	5	9
α-helix	80-82	3
β-strand	88-90	3	10
β-strand	93	1	9
β-strand	98-99	2	9
β-strand	104-108	5	9
β-strand	110-115	6	9
β-strand	118-124	7	9
β-strand	136-144	9	10
β-strand	152-155	4	9
β-strand	160	1	10
α-helix	161	1
β-strand	162	1	9
β-strand	173-184	12	10
β-strand	193-203	11	10

Chain E: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
α-helix	9-13	5
α-helix	16-18	3
β-strand	22	1	11
β-strand	25	1	11
β-strand	27-42	16	12
β-strand	47-64	18	12
α-helix	67-69	3
β-strand	75-79	5	12
α-helix	80-82	3
β-strand	88-90	3	13
β-strand	93	1	12
β-strand	98-99	2	12
β-strand	104-108	5	12
β-strand	110-115	6	12
β-strand	118-124	7	12
β-strand	136-144	9	13
β-strand	152-155	4	12
β-strand	160	1	13
β-strand	162	1	12
β-strand	172-184	13	13
β-strand	193-204	12	13

Chain F: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
α-helix	9-13	5
α-helix	16-18	3
β-strand	22	1	14
β-strand	25	1	14
β-strand	27-42	16	15
β-strand	47-64	18	15
α-helix	67-70	4
β-strand	75-79	5	15
α-helix	80-82	3
β-strand	88-90	3	16
β-strand	93	1	15
α-helix	96-97	2
β-strand	98-99	2	15
β-strand	104-108	5	15
β-strand	110-115	6	15
β-strand	118-124	7	15
β-strand	136-144	9	16
β-strand	152-155	4	15
β-strand	160	1	16
β-strand	162	1	15
β-strand	172-186	15	16
β-strand	189-204	16	16

Chain G: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
α-helix	16-18	3
β-strand	22	1	17
β-strand	25	1	17
β-strand	27-42	16	18
β-strand	47-64	18	18
α-helix	67-69	3
β-strand	75-79	5	18
α-helix	80-82	3
β-strand	88-90	3	5
β-strand	93	1	18
β-strand	98-99	2	18
β-strand	104-108	5	18
β-strand	110-115	6	18
β-strand	118-124	7	18
β-strand	136-144	9	5
β-strand	152-156	5	18
β-strand	160	1	5
β-strand	162	1	18
β-strand	172-186	15	5
β-strand	189-204	16	5

Chain H: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
α-helix	9-13	5
α-helix	16-18	3
β-strand	22	1	19
β-strand	25	1	19
β-strand	27-42	16	20
β-strand	47-64	18	20
α-helix	67-70	4
β-strand	75-79	5	20
α-helix	80-82	3
β-strand	88-90	3	21
β-strand	93	1	20
β-strand	98-99	2	20
β-strand	104-108	5	20
β-strand	110-115	6	20
β-strand	118-124	7	20
β-strand	136-144	9	21
β-strand	152-155	4	20
β-strand	160	1	21
β-strand	162	1	20
β-strand	172-186	15	21
β-strand	189-204	16	21

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble acetylcholine receptor	A, B, C, D, E, F, G, H, I, J	protein	217	APLYSIA CALIFORNICA	Q8WSF8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>2XYT_1 SOLUBLE ACETYLCHOLINE RECEPTOR (chains A, B, C, D, E, F, G, H, I, J)
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKL
NSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQR
LSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQT
RQVQHYSCCPEPYIDVNLVVKFRERRAGNGFFRNLFD

Ligands and cofactors

ID	Name	Formula	Copies
TC9	D-tubocurarine	C37 H42 N2 O6	5

Primary citation

A Structural and Mutagenic Blueprint for Molecular Recognition of Strychnine and D-Tubocurarine by Different Cys-Loop Receptors. Brams, M., Pandya, A., Kuzmin, D. et al. PLoS Biol (2011) 9:1034. DOI 10.1371/JOURNAL.PBIO.1001034 · PubMed

Other PDB entries of the same protein (UniProt Q8WSF8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6T9R 1.72 Å, Aplysia californica AChBP in complex with a cytisine derivative
2WN9 1.75 Å, Crystal structure of Aplysia ACHBP in complex with 4-0H-DMXBA
2PGZ 1.76 Å, Crystal structure of Cocaine bound to an ACh-Binding Protein
2WNJ 1.8 Å, Crystal structure of aplysia achbp in complex with dmxba
8QTL 1.85 Å, Aplysia californica acetylcholine-binding protein in complex with Spiroimine (-)-4 S
2Y7Y 1.9 Å, Aplysia californica achbp in apo state
4XHE 1.9 Å, Crystal Structure of A-AChBP in complex with pinnatoxin A
4ZK4 1.9 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
2XYS 1.91 Å, Crystal structure of Aplysia californica AChBP in complex with strychnine
5TVC 1.93 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
3C84 1.94 Å, Crystal structure of a complex of AChBP from aplysia californica and the neonicotinoid…
2YMD 1.96 Å, Crystal structure of a mutant binding protein (5HTBP-AChBP) in complex with serotonin…

Browse structure collections

About this viewer

MolViewer shows 2XYT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.