2XZE: AMSH-ESCRT-III CHMP3 interaction

Structural basis for AMSH-ESCRT-III CHMP3 interaction. Determined by X-ray diffraction at 1.75 Å resolution. Released 24 Aug 2011.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 3,091
Mol. weight: 42.99 kDa
Released: 24 Aug 2011

Explore 2XZE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XZE contains 19 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	11-22	12
α-helix	33-53	21
α-helix	56-67	12
α-helix	68-73	6
α-helix	74-76	3
α-helix	88-94	7
α-helix	95-99	5
α-helix	100-137	38

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	11-23	13
α-helix	33-52	20
α-helix	56-68	13
α-helix	69-73	5
α-helix	74-76	3
α-helix	88-94	7
α-helix	95-99	5
α-helix	100-138	39

Chain Q: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	201-220	20

Chain R: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	204-212	9
α-helix	214-220	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stam-binding protein	A, B	protein	146	HOMO SAPIENS	O95630 (AlphaFold model)
Charged multivesicular body protein 3	Q, R	protein	40	HOMO SAPIENS	Q9Y3E7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2XZE_1 STAM-BINDING PROTEIN (chains A, B)
MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAF
ILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTE
YNEEKKKEAEELARNMAIQQELEKEK

Sequence of entity 2 (Q, R), FASTA

>2XZE_2 CHARGED MULTIVESICULAR BODY PROTEIN 3 (chains Q, R)
KVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS

Primary citation

Structural Basis for Escrt-III Chmp3 Recruitment of Amsh. Solomons, J., Sabin, C., Poudevigne, E. et al. Structure (2011) 19:1149. DOI 10.1016/J.STR.2011.05.011 · PubMed

Other PDB entries of the same protein (UniProt O95630 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RZV 1.67 Å, The Crystal Structure of a E280A Mutant of the Catalytic Domain of AMSH
3RZU 2.5 Å, The Crystal Structure of the Catalytic Domain of AMSH
9LE4 2.6 Å, Crystal structure of the MIT-CD complex of STAMBP
5IXF Solution structure of the STAM2 SH3 with AMSH derived peptide complex

Browse structure collections

About this viewer

MolViewer shows 2XZE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.