3RZV: E280A Mutant of the Catalytic Domain of AMSH

The Crystal Structure of a E280A Mutant of the Catalytic Domain of AMSH. Determined by X-ray diffraction at 1.67 Å resolution. Released 19 Oct 2011.

Method: X-ray diffraction
Resolution: 1.67 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,633
Mol. weight: 23.22 kDa
Ligands: ZN
Released: 19 Oct 2011

Explore 3RZV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RZV contains 6 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	247-250	4
β-strand	251	1	1
β-strand	254	1	1
β-strand	257-260	4	2
α-helix	263-276	14
β-strand	282-290	9	2
β-strand	293-301	9	2
β-strand	304-306	3	3
β-strand	311-313	3	3
α-helix	316-326	11
α-helix	328	1
β-strand	329-336	8	2
α-helix	346-358	13
β-strand	363-368	6	2
β-strand	373-379	7	2
α-helix	381-389	9
β-strand	405-407	3	2
β-strand	411-414	4	2
β-strand	419-422	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
STAM-binding protein	A	protein	211	Homo sapiens	O95630 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3RZV_1 STAM-binding protein (chains A)
GPLGSSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASA
NTARGVATCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGW
IHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQK
GFHPHSKDPPLFCSCSHVTVVDRAVTITDLR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural and Thermodynamic Comparison of the Catalytic Domain of AMSH and AMSH-LP: Nearly Identical Fold but Different Stability. Davies, C.W., Paul, L.N., Kim, M.I. et al. J Mol Biol (2011) 413:416-429. DOI 10.1016/j.jmb.2011.08.029 · PubMed

Other PDB entries of the same protein (UniProt O95630 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XZE 1.75 Å, Structural basis for AMSH-ESCRT-III CHMP3 interaction
3RZU 2.5 Å, The Crystal Structure of the Catalytic Domain of AMSH
9LE4 2.6 Å, Crystal structure of the MIT-CD complex of STAMBP
5IXF Solution structure of the STAM2 SH3 with AMSH derived peptide complex

Browse structure collections

About this viewer

MolViewer shows 3RZV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.