5IXF: STAM2 SH3 with AMSH derived peptide complex

Solution structure of the STAM2 SH3 with AMSH derived peptide complex. Determined by solution NMR. Released 7 Dec 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 657
Mol. weight: 13.9 kDa
Released: 7 Dec 2016

Explore 5IXF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IXF contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	210-212	3
β-strand	213-216	4	1
β-strand	227	1	1
β-strand	235-238	4	1
β-strand	247-250	4	1
β-strand	255-258	4	1
α-helix	260-262	3
β-strand	263-264	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal transducing adapter molecule 2	A	protein	109	Homo sapiens	O75886 (AlphaFold model)
STAM-binding protein	B	protein	14	Homo sapiens	O95630 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5IXF_1 Signal transducing adapter molecule 2 (chains A)
GAMGMNKNKEDEDIAKAIELSLQEQKQQHTETKSLYPSSEIQLNNKVARKVRALYDFEAV
EDNELTFKHGEIIIVLDDSDANWWKGENHRGIGLFPSDFVTTNLNIETE

Sequence of entity 2 (B), FASTA

>5IXF_2 STAM-binding protein (chains B)
AKPPVVDRSLKPGA

Primary citation

NMR Reveals the Interplay among the AMSH SH3 Binding Motif, STAM2, and Lys63-Linked Diubiquitin. Hologne, M., Cantrelle, F.X., Riviere, G. et al. J Mol Biol (2016) 428:4544-4558. DOI 10.1016/j.jmb.2016.10.002 · PubMed

Other PDB entries of the same protein (UniProt O75886 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CRV 2.0 Å, Crystal structure of the Bro domain of HD-PTP in a complex with the core region of STAM2
1X2Q Solution structure of the SH3 domain of the Signal transducing adaptor molecule 2
1X5B The solution structure of the VHS domain of human Signal transducing adaptor molecule 2
2L0T Solution structure of the complex of ubiquitin and the VHS domain of Stam2

Browse structure collections

About this viewer

MolViewer shows 5IXF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.