Structure of N-terminal domain of Candida albicans als9-2 (Pt derivative). Determined by X-ray diffraction at 1.98 Å resolution. Released 5 Oct 2011.
Explore 2Y7M in 3D Show helices and sheets RCSB PDB PDBe
2Y7M contains 6 α-helices and 25 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3 | 1 | 1 |
| β-strand | 8-16 | 9 | 2 |
| β-strand | 32-41 | 10 | 2 |
| β-strand | 50-56 | 7 | 1 |
| β-strand | 58-61 | 4 | 2 |
| β-strand | 67-72 | 6 | 1 |
| β-strand | 75-83 | 9 | 1 |
| β-strand | 91-98 | 8 | 1 |
| α-helix | 99-100 | 2 | |
| β-strand | 107-118 | 12 | 2 |
| α-helix | 126-131 | 6 | |
| β-strand | 138-146 | 9 | 1 |
| β-strand | 149-157 | 9 | 1 |
| α-helix | 158-160 | 3 | |
| β-strand | 168-174 | 7 | 3 |
| α-helix | 175-177 | 3 | |
| β-strand | 179-185 | 7 | 3 |
| α-helix | 186-188 | 3 | |
| β-strand | 193-203 | 11 | 4 |
| β-strand | 206-218 | 13 | 3 |
| β-strand | 221 | 1 | 5 |
| β-strand | 227 | 1 | 5 |
| β-strand | 231 | 1 | 3 |
| β-strand | 234-239 | 6 | 4 |
| β-strand | 243-251 | 9 | 4 |
| α-helix | 252 | 1 | |
| β-strand | 256-265 | 10 | 3 |
| β-strand | 270-275 | 6 | 4 |
| β-strand | 278-281 | 4 | 4 |
| β-strand | 287-288 | 2 | 4 |
| β-strand | 291-296 | 6 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Agglutinin-like ALS9 protein | A | protein | 312 | CANDIDA ALBICANS | A0A1D8PQ86 (AlphaFold model) |
>2Y7M_1 AGGLUTININ-LIKE ALS9 PROTEIN (chains A) MKTITGVFNSFDSLTWTRSVEYVYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFK FITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNV GGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKL SSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCT STSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWGYKN SEADSDGDVIVV
Structural basis for the broad specificity to host-cell ligands by the pathogenic fungus Candida albicans. Salgado, P.S., Yan, R., Taylor, J.D. et al. Proc Natl Acad Sci U S A (2011) 108:15775-15779. DOI 10.1073/pnas.1103496108 · PubMed
Other PDB entries of the same protein (UniProt A0A1D8PQ86 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2Y7M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.