Structure of N-terminal domain of Candida albicans als9-2 - Apo Form. Determined by X-ray diffraction at 2.0 Å resolution. Released 5 Oct 2011.
Explore 2Y7N in 3D Show helices and sheets RCSB PDB PDBe
2Y7N contains 7 α-helices and 25 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 1 |
| β-strand | 7-15 | 9 | 2 |
| β-strand | 31-40 | 10 | 2 |
| β-strand | 49-55 | 7 | 1 |
| β-strand | 57-60 | 4 | 2 |
| β-strand | 66-71 | 6 | 1 |
| β-strand | 74-82 | 9 | 1 |
| β-strand | 90-97 | 8 | 1 |
| α-helix | 98-99 | 2 | |
| β-strand | 106-117 | 12 | 2 |
| α-helix | 125-130 | 6 | |
| β-strand | 137-145 | 9 | 1 |
| β-strand | 148-156 | 9 | 1 |
| α-helix | 157-159 | 3 | |
| β-strand | 167-173 | 7 | 3 |
| α-helix | 174-176 | 3 | |
| β-strand | 178-184 | 7 | 3 |
| α-helix | 185-187 | 3 | |
| β-strand | 192-202 | 11 | 4 |
| β-strand | 205-217 | 13 | 3 |
| β-strand | 220 | 1 | 5 |
| β-strand | 226 | 1 | 5 |
| β-strand | 230 | 1 | 3 |
| β-strand | 233-238 | 6 | 4 |
| β-strand | 242-250 | 9 | 4 |
| α-helix | 251 | 1 | |
| β-strand | 255-264 | 10 | 3 |
| β-strand | 269-274 | 6 | 4 |
| β-strand | 277-280 | 4 | 4 |
| β-strand | 286-287 | 2 | 4 |
| β-strand | 290-295 | 6 | 4 |
| α-helix | 298-299 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Agglutinin-like ALS9 protein | A | protein | 312 | CANDIDA ALBICANS | A0A1D8PQ86 (AlphaFold model) |
>2Y7N_1 AGGLUTININ-LIKE ALS9 PROTEIN (chains A) MKTITGVFNSFDSLTWTRSVEYVYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFK FITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNV GGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKL SSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCT STSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWGYKN SEADSDGDVIVV
Structural Basis for the Broad Specificity to Host- Cell Ligands by the Pathogenic Fungus Candida Albicans. Salgado, P.S., Yan, R., Taylor, J.D. et al. Proc Natl Acad Sci U S A (2011) 108:15775. DOI 10.1073/PNAS.1103496108 · PubMed
Other PDB entries of the same protein (UniProt A0A1D8PQ86 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2Y7N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.