2YH5: C-terminal domain of BamC

Structure of the C-terminal domain of BamC. Determined by X-ray diffraction at 1.25 Å resolution. Released 25 May 2011.

Method: X-ray diffraction
Resolution: 1.25 Å
Organism: ESCHERICHIA COLI
Chains: 1
Atoms: 1,018
Mol. weight: 14.09 kDa
Ligands: PO4
Released: 25 May 2011

Explore 2YH5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YH5 contains 8 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	206-210	5	1
β-strand	216-221	6	1
α-helix	224-237	14
β-strand	240-246	7	1
α-helix	247-249	3
β-strand	251-256	6	1
α-helix	258-260	3
α-helix	261-267	7
α-helix	274-275	2
β-strand	277-286	10	1
β-strand	289-295	7	1
α-helix	300	1
β-strand	301	1	1
α-helix	302-303	2
α-helix	304-321	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dapx protein	A	protein	127	ESCHERICHIA COLI	P0A903 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YH5_1 DAPX PROTEIN (chains A)
TTMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGMKVTDSTRSQGNMAVTYKPLSD
SDWQELGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAFSKL
EHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2

Primary citation

Structural Basis of Outer Membrane Protein Biogenesis in Bacteria. Albrecht, R., Zeth, K. J Biol Chem (2011) 286:27792. DOI 10.1074/JBC.M111.238931 · PubMed

Other PDB entries of the same protein (UniProt P0A903 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SNS 1.5 Å, Crystal structure of the C-terminal domain of Escherichia coli lipoprotein BamC
2YH6 1.55 Å, Structure of the N-terminal domain of BamC from E. coli
9CNW 2.6 Å, CryoEM structure of the APO-BAM complex in DDM detergent
9HG6 2.73 Å, BAM-SurA complex in the swing-in state
9HG5 2.82 Å, BAM-SurA complex in the swing-in state with full length BamC resolved
9HG7 2.83 Å, BAM-SurA complex in the swing-out state
9HG9 2.88 Å, BAM-SurA-darobactin complex in the swing-in state
3TGO 2.9 Å, Crystal structure of the E. coli BamCD complex
5D0O 2.9 Å, BamABCDE complex, outer membrane beta barrel assembly machinery entire complex
8PZV 2.9 Å, Wait Complex: BAM bound Darobactin-B and Extended SurA
9HG8 2.9 Å, BAM-SurA complex in the swing-out state with BamC resolved
8ADG 3.0 Å, Cryo-EM structure of Darobactin 22 bound BAM complex

Browse structure collections

About this viewer

MolViewer shows 2YH5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.