2YH6: N-terminal domain of BamC from E. coli

Structure of the N-terminal domain of BamC from E. coli. Determined by X-ray diffraction at 1.55 Å resolution. Released 25 May 2011.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: ESCHERICHIA COLI
Chains: 4
Atoms: 3,572
Mol. weight: 50.71 kDa
Released: 25 May 2011

Explore 2YH6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YH6 contains 15 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	79-84	6	1
α-helix	92-102	11
β-strand	107-111	5	1
α-helix	112-114	3
β-strand	116-119	4	1
β-strand	122-124	3	1
α-helix	129-131	3
β-strand	133-144	12	1
β-strand	147-159	13	1
β-strand	162-164	3	1
α-helix	167-184	18

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	79-84	6	1
α-helix	92-102	11
β-strand	107-111	5	1
α-helix	112-114	3
β-strand	116-119	4	1
β-strand	122-124	3	1
β-strand	133-141	9	1
β-strand	148-159	12	1
β-strand	162-163	2	1
α-helix	167-186	20

Chains C and D: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	79-84	6	2
α-helix	92-102	11
β-strand	107-111	5	2
α-helix	112-114	3
β-strand	116-119	4	2
β-strand	122-124	3	2
α-helix	129-131	3
β-strand	133-144	12	2
β-strand	147-159	13	2
β-strand	162-163	2	2
α-helix	167-186	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lipoprotein 34	A, B, C, D	protein	112	ESCHERICHIA COLI	P0A903 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2YH6_1 LIPOPROTEIN 34 (chains A, B, C, D)
GDTASLLVENGRGNTLWPQVVSVLQAKNYTITQRDDAGQTLTTDWVQWNRLDEDEQYRGR
YQISVKPQGYQQAVTVKLLNLEQAGKPVADAASMQRYSTEMMNVISAGLDKS

Primary citation

Structural Basis of Outer Membrane Protein Biogenesis in Bacteria. Albrecht, R., Zeth, K. J Biol Chem (2011) 286:27792. DOI 10.1074/JBC.M111.238931 · PubMed

Other PDB entries of the same protein (UniProt P0A903 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2YH5 1.25 Å, Structure of the C-terminal domain of BamC
3SNS 1.5 Å, Crystal structure of the C-terminal domain of Escherichia coli lipoprotein BamC
9CNW 2.6 Å, CryoEM structure of the APO-BAM complex in DDM detergent
9HG6 2.73 Å, BAM-SurA complex in the swing-in state
9HG5 2.82 Å, BAM-SurA complex in the swing-in state with full length BamC resolved
9HG7 2.83 Å, BAM-SurA complex in the swing-out state
9HG9 2.88 Å, BAM-SurA-darobactin complex in the swing-in state
3TGO 2.9 Å, Crystal structure of the E. coli BamCD complex
5D0O 2.9 Å, BamABCDE complex, outer membrane beta barrel assembly machinery entire complex
8PZV 2.9 Å, Wait Complex: BAM bound Darobactin-B and Extended SurA
9HG8 2.9 Å, BAM-SurA complex in the swing-out state with BamC resolved
8ADG 3.0 Å, Cryo-EM structure of Darobactin 22 bound BAM complex

Browse structure collections

About this viewer

MolViewer shows 2YH6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.