2YO0: PDB entry 2YO0

Salmonella enterica SadA 1049-1304 fused to GCN4 adaptors (SadAK9-cfI). Determined by X-ray diffraction at 2.8 Å resolution. Released 12 Dec 2012.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: SACCHAROMYCES CEREVISIAE, SALMONELLA ENTERICA SUBSP. ENTERICA SEROVAR TYPHIMURIUM
Chains: 1
Atoms: 1,989
Mol. weight: 34.04 kDa
Released: 12 Dec 2012

Explore 2YO0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YO0 contains 7 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	1071-1072	2
β-strand	1073-1074	2	1
β-strand	1081-1082	2	2
β-strand	1087-1088	2	1
β-strand	1094-1096	3	2
β-strand	1101-1102	2	1
β-strand	1110-1112	3	2
β-strand	1117-1118	2	1
β-strand	1124-1126	3	2
β-strand	1131	1	1
β-strand	1140	1	3
β-strand	1149	1	3
β-strand	1155-1156	2	2
β-strand	1159	1	4
β-strand	1162	1	4
α-helix	1178-1179	2
α-helix	1181-1218	38
α-helix	1221-1224	4
α-helix	1238-1240	3
β-strand	1241-1242	2	5
β-strand	1248-1250	3	6
β-strand	1255-1256	2	5
β-strand	1262-1264	3	6
β-strand	1270	1	5
β-strand	1277	1	6
α-helix	1290-1293	4
α-helix	1302-1335	34

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
General control protein GCN4, putative inner membrane protein	A	protein	322	SACCHAROMYCES CEREVISIAE, SALMONELLA ENTERICA SUBSP. ENTERICA SEROVAR TYPHIMURIUM	P03069 (AlphaFold model), Q8ZL64 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YO0_1 GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEIN (chains A)
MKQIEDKIEEILSKIYHIENEIARIKKLIQNAIGAVTTTPTKYYHANSTEEDSLAVGTDS
LAMGAKTIVNADAGIGIGLNTLVMADAINGIAIGSNARANHANSIAMGNGSQTTRGAQTD
YTAYNMDTPQNSVGEFSVGSEDGQRQITNVAAGSADTDAVNVGQLKVTDAQVSRNTQSIT
NLNTQVSNLDTRVTNIENGIGDIVTTGSTKYFKTNTDGADANAQGADSVAIGSGSIAAAE
NSVALGTNSVADEANTVSVGSSTQQRRITNVAAGVNNTDAVNVAQMKQIEDKIEEILSKI
YHIENEIARIKKLIKLHHHHHH

Primary citation

Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria. Hartmann, M.D., Grin, I., Dunin-Horkawicz, S. et al. Proc Natl Acad Sci U S A (2012) 109:20907. DOI 10.1073/PNAS.1211872110 · PubMed

Other PDB entries of the same protein (UniProt P03069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AZD 0.98 Å, Crystal structure of tropomyosin N-terminal fragment at 0.98A resolution
2WQ1 1.08 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating bromide
2WQ0 1.12 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride
4OWI 1.2 Å, peptide structure
2WQ3 1.22 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride and nitrate
2HY6 1.25 Å, A seven-helix coiled coil
2WPZ 1.25 Å, GCN4 leucine zipper mutant with two VxxNxxx motifs coordinating chloride
6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
2IPZ 1.35 Å, A Parallel Coiled-Coil Tetramer with Offset Helices
2YNY 1.35 Å, Salmonella enterica SadA 255-302 fused to GCN4 adaptors (SadAK1)
5APU 1.35 Å, Sequence IANKEDKAD inserted between GCN4 adaptors - Structure A9b black
2WQ2 1.36 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating iodide

Browse structure collections

About this viewer

MolViewer shows 2YO0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.