2YO2: PDB entry 2YO2

Salmonella enterica SadA 255-358 fused to GCN4 adaptors (SadAK12). Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Dec 2012.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: SACCHAROMYCES CEREVISIAE, SALMONELLA ENTERICA SUBSP. ENTERICA SEROVAR TYPHIMURIUM
Chains: 1
Atoms: 1,289
Mol. weight: 18.4 kDa
Released: 12 Dec 2012

Explore 2YO2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YO2 contains 7 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	229-265	37
β-strand	271	1	1
α-helix	276	1
β-strand	277	1	1
α-helix	278-280	3
β-strand	282-284	3	2
β-strand	287-289	3	2
α-helix	292-316	25
β-strand	319-321	3	3
α-helix	322-324	3
β-strand	326-328	3	3
β-strand	330-331	2	4
β-strand	334-335	2	4
α-helix	341-345	5
α-helix	356-385	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
General control protein GCN4, putative inner membrane protein	A	protein	170	SACCHAROMYCES CEREVISIAE, SALMONELLA ENTERICA SUBSP. ENTERICA SEROVAR TYPHIMURIUM	P03069 (AlphaFold model), Q8ZL64 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YO2_1 GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEIN (chains A)
MKQIEDKIEEILSKIYHIENEIARIKKLIYSLSQSVADRLGGGASVNSDGTVNAPLYEVG
TGIYNNVGSALSALNTSITNTEASVAGLAEDALLWDESISAFSASHTGNASKITNLAAGT
LAADSTDAVNGSQMKQIEDKIEEILSKIYHIENEIARIKKLIKLHHHHHH

Primary citation

Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria. Hartmann, M.D., Grin, I., Dunin-Horkawicz, S. et al. Proc Natl Acad Sci U S A (2012) 109:20907. DOI 10.1073/PNAS.1211872110 · PubMed

Other PDB entries of the same protein (UniProt P03069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AZD 0.98 Å, Crystal structure of tropomyosin N-terminal fragment at 0.98A resolution
2WQ1 1.08 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating bromide
2WQ0 1.12 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride
4OWI 1.2 Å, peptide structure
2WQ3 1.22 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride and nitrate
2HY6 1.25 Å, A seven-helix coiled coil
2WPZ 1.25 Å, GCN4 leucine zipper mutant with two VxxNxxx motifs coordinating chloride
6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
2IPZ 1.35 Å, A Parallel Coiled-Coil Tetramer with Offset Helices
2YNY 1.35 Å, Salmonella enterica SadA 255-302 fused to GCN4 adaptors (SadAK1)
5APU 1.35 Å, Sequence IANKEDKAD inserted between GCN4 adaptors - Structure A9b black
2WQ2 1.36 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating iodide

Browse structure collections

About this viewer

MolViewer shows 2YO2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.