2YO3: PDB entry 2YO3

Salmonella enterica SadA 1185-1386 fused to GCN4 adaptors (SadAK14). Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Dec 2012.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: SACCHAROMYCES CEREVISIAE, SALMONELLA ENTERICA SUBSP. ENTERICA SEROVAR TYPHIMURIUM
Chains: 3
Atoms: 6,246
Mol. weight: 86.83 kDa
Released: 12 Dec 2012

Explore 2YO3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YO3 contains 27 α-helices and 66 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	1158-1215	58
α-helix	1216-1220	5
α-helix	1221-1225	5
β-strand	1231-1234	4	1
α-helix	1238-1240	3
β-strand	1241-1242	2	2
β-strand	1248-1250	3	3
β-strand	1255-1256	2	2
β-strand	1262-1264	3	3
β-strand	1269-1270	2	2
β-strand	1275-1277	3	3
β-strand	1285	1	4
β-strand	1286-1288	3	1
β-strand	1290	1	5
α-helix	1291-1293	3
β-strand	1299	1	6
β-strand	1301	1	7
α-helix	1302-1309	8
β-strand	1312	1	8
β-strand	1314	1	9
β-strand	1316-1317	2	10
β-strand	1323-1324	2	10
β-strand	1327-1329	3	11
β-strand	1338	1	12
β-strand	1339-1341	3	13
β-strand	1343	1	14
α-helix	1344-1346	3
β-strand	1352	1	15
α-helix	1353	1
β-strand	1354	1	16
α-helix	1355-1411	57

Chain B: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	1157-1219	63
α-helix	1222-1225	4
β-strand	1231-1233	3	17
α-helix	1238-1240	3
β-strand	1241-1242	2	18
β-strand	1247-1250	4	1
β-strand	1255-1256	2	18
β-strand	1262-1264	3	1
β-strand	1269-1270	2	18
β-strand	1275-1277	3	1
β-strand	1285	1	5
β-strand	1286-1288	3	17
β-strand	1290	1	19
α-helix	1291-1293	3
β-strand	1299	1	20
α-helix	1300	1
β-strand	1301	1	6
α-helix	1302-1310	9
β-strand	1312	1	21
β-strand	1314	1	8
α-helix	1315	1
β-strand	1316-1317	2	22
α-helix	1318	1
β-strand	1323-1324	2	22
β-strand	1327-1329	3	13
β-strand	1338	1	14
β-strand	1339-1341	3	23
β-strand	1343	1	24
α-helix	1344-1346	3
β-strand	1352	1	25
β-strand	1354	1	15
α-helix	1355-1411	57

Chain C: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	1157-1225	69
β-strand	1231-1233	3	3
α-helix	1238-1240	3
β-strand	1241-1242	2	26
β-strand	1248-1250	3	17
β-strand	1255-1256	2	26
β-strand	1262-1264	3	17
β-strand	1269-1270	2	26
β-strand	1275-1277	3	17
β-strand	1285	1	19
β-strand	1286-1288	3	3
β-strand	1290	1	4
α-helix	1291-1293	3
β-strand	1299	1	7
β-strand	1301	1	20
α-helix	1302-1309	8
β-strand	1312	1	9
β-strand	1314	1	21
α-helix	1315	1
β-strand	1316-1317	2	27
β-strand	1323-1324	2	27
β-strand	1327-1329	3	23
β-strand	1338	1	24
β-strand	1339-1341	3	11
β-strand	1343	1	12
α-helix	1344-1346	3
β-strand	1352	1	16
α-helix	1353	1
β-strand	1354	1	25
α-helix	1355-1411	57

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
General control protein GCN4, putative inner membrane protein, general control protein GCN4	A, B, C	protein	268	SACCHAROMYCES CEREVISIAE, SALMONELLA ENTERICA SUBSP. ENTERICA SEROVAR TYPHIMURIUM	P03069 (AlphaFold model), Q8ZL64 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2YO3_1 GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEIN, GENERAL CONTROL PROTEIN GCN4 (chains A, B, C)
MKQIEDKIEEILSKIYHIENEIARIKKLIKVTDAQVSRNTQSITNLNTQVSNLDTRVTNI
ENGIGDIVTTGSTKYFKTNTDGADANAQGADSVAIGSGSIAAAENSVALGTNSVADEANT
VSVGSSTQQRRITNVAAGVNNTDAVNVAQLKASEAGSVRYETNADGSVNYSVLNLGDGSG
GTTRIGNVSAAVNDTDAVNYAQLKRSVEEANTYTDQKMGEMNSKIKGVENKMKQIEDKIE
EILSKIYHIENEIARIKKLIKLHHHHHH

Primary citation

Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria. Hartmann, M.D., Grin, I., Dunin-Horkawicz, S. et al. Proc Natl Acad Sci U S A (2012) 109:20907. DOI 10.1073/PNAS.1211872110 · PubMed

Other PDB entries of the same protein (UniProt P03069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AZD 0.98 Å, Crystal structure of tropomyosin N-terminal fragment at 0.98A resolution
2WQ1 1.08 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating bromide
2WQ0 1.12 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride
4OWI 1.2 Å, peptide structure
2WQ3 1.22 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride and nitrate
2HY6 1.25 Å, A seven-helix coiled coil
2WPZ 1.25 Å, GCN4 leucine zipper mutant with two VxxNxxx motifs coordinating chloride
6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
2IPZ 1.35 Å, A Parallel Coiled-Coil Tetramer with Offset Helices
2YNY 1.35 Å, Salmonella enterica SadA 255-302 fused to GCN4 adaptors (SadAK1)
5APU 1.35 Å, Sequence IANKEDKAD inserted between GCN4 adaptors - Structure A9b black
2WQ2 1.36 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating iodide

Browse structure collections

About this viewer

MolViewer shows 2YO3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.