Crystal structure of immune receptor. Determined by X-ray diffraction at 2.2 Å resolution. Released 9 Oct 2007.
Explore 2Z35 in 3D Show helices and sheets RCSB PDB PDBe
2Z35 contains 3 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-4 | 3 | 1 |
| β-strand | 9-13 | 5 | 2 |
| α-helix | 16-17 | 2 | |
| β-strand | 18-20 | 3 | 3 |
| β-strand | 23-25 | 3 | 1 |
| β-strand | 31-37 | 7 | 2 |
| β-strand | 44-49 | 6 | 2 |
| β-strand | 55-58 | 4 | 3 |
| β-strand | 62-65 | 4 | 3 |
| β-strand | 67 | 1 | 1 |
| β-strand | 72 | 1 | 1 |
| β-strand | 75-77 | 3 | 3 |
| β-strand | 87-93 | 7 | 2 |
| β-strand | 104-106 | 3 | 2 |
| β-strand | 110-115 | 6 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 4 |
| β-strand | 10-13 | 4 | 5 |
| β-strand | 19-25 | 7 | 4 |
| β-strand | 31-38 | 8 | 5 |
| β-strand | 42-49 | 8 | 5 |
| β-strand | 56-57 | 2 | 5 |
| β-strand | 66-68 | 3 | 4 |
| β-strand | 74-79 | 6 | 4 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-96 | 9 | 5 |
| α-helix | 97-99 | 3 | |
| β-strand | 105-108 | 4 | 5 |
| β-strand | 112-116 | 5 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| T-cell receptor alpha-chain | A | protein | 112 | Mus musculus | Q5R1F5 (AlphaFold model) |
| T-cell receptor beta-chain | B | protein | 111 | Mus musculus | A2NTY6 (AlphaFold model) |
>2Z35_1 T-cell receptor alpha-chain (chains A) DSVTQTGGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRG FEATYNKEATSFHLQKASVQESDSAVYYCALSENYGNEKITFGAGTKLTIKP
>2Z35_2 T-cell receptor beta-chain (chains B) AVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHGLRLIYYSYGAGSTEKGDIPD GYKASRPSQENFSLTLESATPSQTSVYFCASGDASGAETLYFGPGTRLTVL
Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'. Feng, D., Bond, C.J., Ely, L.K. et al. Nat Immunol (2007) 8:975-983. DOI 10.1038/ni1502 · PubMed
Other PDB entries of the same protein (UniProt Q5R1F5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2Z35 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.