Crystal structure of the TV8 hybrid of human TLR4 and hagfish VLRB.61. Determined by X-ray diffraction at 2.0 Å resolution. Released 18 Sept 2007.
Explore 2Z63 in 3D Show helices and sheets RCSB PDB PDBe
2Z63 contains 12 α-helices and 51 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 30-33 | 4 | 1 |
| β-strand | 37-39 | 3 | 1 |
| β-strand | 58-60 | 3 | 1 |
| β-strand | 68-69 | 2 | 2 |
| β-strand | 82-84 | 3 | 1 |
| β-strand | 92-93 | 2 | 2 |
| β-strand | 106-108 | 3 | 1 |
| β-strand | 116-117 | 2 | 2 |
| β-strand | 130-132 | 3 | 1 |
| β-strand | 154-156 | 3 | 1 |
| α-helix | 166-168 | 3 | |
| α-helix | 169-173 | 5 | |
| β-strand | 179-181 | 3 | 1 |
| β-strand | 189-190 | 2 | 3 |
| α-helix | 192-195 | 4 | |
| α-helix | 196-199 | 4 | |
| β-strand | 207-209 | 3 | 1 |
| β-strand | 217-218 | 2 | 3 |
| β-strand | 227-234 | 8 | 1 |
| α-helix | 242-248 | 7 | |
| β-strand | 254-262 | 9 | 1 |
| β-strand | 270-271 | 2 | 4 |
| α-helix | 278-282 | 5 | |
| β-strand | 284-292 | 9 | 1 |
| β-strand | 295-297 | 3 | 4 |
| α-helix | 305-307 | 3 | |
| β-strand | 312-316 | 5 | 1 |
| β-strand | 319-320 | 2 | 4 |
| β-strand | 325 | 1 | 5 |
| β-strand | 334-338 | 5 | 1 |
| β-strand | 341 | 1 | 4 |
| β-strand | 347 | 1 | 5 |
| β-strand | 349 | 1 | 6 |
| β-strand | 355-359 | 5 | 1 |
| β-strand | 362 | 1 | 4 |
| β-strand | 366 | 1 | 7 |
| β-strand | 371 | 1 | 6 |
| β-strand | 377-379 | 3 | 1 |
| β-strand | 386 | 1 | 7 |
| β-strand | 387-392 | 6 | 8 |
| α-helix | 393-396 | 4 | |
| β-strand | 403-405 | 3 | 1 |
| β-strand | 411-419 | 9 | 8 |
| β-strand | 426-428 | 3 | 1 |
| β-strand | 433-435 | 3 | 8 |
| β-strand | 451-453 | 3 | 1 |
| β-strand | 460-461 | 2 | 9 |
| β-strand | 475-477 | 3 | 1 |
| β-strand | 482-483 | 2 | 9 |
| α-helix | 484-486 | 3 | |
| β-strand | 487-488 | 2 | 10 |
| β-strand | 500-502 | 3 | 1 |
| β-strand | 510-511 | 2 | 10 |
| β-strand | 524-526 | 3 | 1 |
| β-strand | 548-550 | 3 | 1 |
| β-strand | 556 | 1 | 11 |
| α-helix | 564-572 | 9 | |
| α-helix | 574-576 | 3 | |
| β-strand | 577-578 | 2 | 1 |
| β-strand | 582 | 1 | 12 |
| β-strand | 583 | 1 | 11 |
| β-strand | 589 | 1 | 12 |
| α-helix | 590-592 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Toll-like receptor 4, Variable lymphocyte receptor B | A | protein | 570 | Homo sapiens, Eptatretus burgeri | O00206 (AlphaFold model), Q4G1L2 (AlphaFold model) |
>2Z63_1 Toll-like receptor 4, Variable lymphocyte receptor B (chains A) EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLS RCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPI GHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNL SLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNE GNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDF SYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLS FKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSL RNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQC QLEQLSPTAFNSLSSLQVLNMASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYL SRWLNKNSQKEQGSAKCSGSGKPVRSIICP
Crystal Structure of the TLR4-MD-2 Complex with Bound Endotoxin Antagonist Eritoran. Kim, H.M., Park, B.S., Kim, J.-I. et al. Cell (2007) 130:906-917. DOI 10.1016/j.cell.2007.08.002 · PubMed
Other PDB entries of the same protein (UniProt O00206 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2Z63 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.