2Z66: VT3 hybrid of human TLR4 and hagfish VLRB.61

Crystal structure of the VT3 hybrid of human TLR4 and hagfish VLRB.61. Determined by X-ray diffraction at 1.9 Å resolution. Released 18 Sept 2007.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Eptatretus burgeri, Homo sapiens
Chains: 4
Atoms: 10,688
Mol. weight: 146.51 kDa
Released: 18 Sept 2007

Explore 2Z66 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Z66 contains 39 α-helices and 104 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and D: 10 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	29-31	3	1
β-strand	34-36	3	1
α-helix	45-46	2
β-strand	55-57	3	1
β-strand	79-81	3	1
β-strand	387-392	6	2
α-helix	393-396	4
β-strand	403-405	3	1
β-strand	411-419	9	2
β-strand	426-428	3	1
β-strand	433-435	3	2
β-strand	451-453	3	1
β-strand	460-461	2	3
β-strand	475-477	3	1
β-strand	482-483	2	3
α-helix	484-486	3
β-strand	487-488	2	4
β-strand	500-502	3	1
β-strand	510-511	2	4
β-strand	524-526	3	1
β-strand	534	1	5
α-helix	538-540	3
β-strand	548-550	3	1
β-strand	558	1	5
β-strand	573-575	3	1
β-strand	581-582	2	6
α-helix	585-587	3
α-helix	588-596	9
α-helix	598-600	3
β-strand	601	1	1
α-helix	604-606	3
β-strand	608	1	7
β-strand	609-611	3	6
α-helix	613-615	3
β-strand	619	1	7
α-helix	620-622	3

Chain C: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	29-31	3	15
β-strand	34-36	3	15
α-helix	45-46	2
β-strand	55-57	3	15
β-strand	79-81	3	15
β-strand	387-392	6	16
α-helix	393-396	4
β-strand	403-405	3	15
β-strand	411-419	9	16
β-strand	426-428	3	15
β-strand	433-435	3	16
β-strand	451-453	3	15
β-strand	460-461	2	17
β-strand	475-477	3	15
β-strand	482-483	2	17
α-helix	484-486	3
β-strand	487-488	2	18
β-strand	500-502	3	15
β-strand	510-511	2	18
β-strand	524-526	3	15
β-strand	534	1	19
α-helix	538-540	3
β-strand	548-550	3	15
β-strand	558	1	19
β-strand	573-575	3	15
β-strand	581-582	2	20
α-helix	585-587	3
α-helix	588-596	9
β-strand	601	1	15
α-helix	604-606	3
β-strand	608	1	21
β-strand	609-611	3	20
α-helix	613-615	3
β-strand	619	1	21
α-helix	620-622	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Variable lymphocyte receptor B, Toll-like receptor 4	A, B, C, D	protein	306	Eptatretus burgeri, Homo sapiens	O00206 (AlphaFold model), Q4G1L2 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2Z66_1 Variable lymphocyte receptor B, Toll-like receptor 4 (chains A, B, C, D)
CPSRCSCSGTEIRCNSKGLTSVPTGIPSSATRLELESNKLQSLPHGVFDKLTQLTKLSLS
SNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFS
VFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFL
DLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKK
QELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVL
SLNITC

Primary citation

Crystal Structure of the TLR4-MD-2 Complex with Bound Endotoxin Antagonist Eritoran. Kim, H.M., Park, B.S., Kim, J.-I. et al. Cell (2007) 130:906-917. DOI 10.1016/j.cell.2007.08.002 · PubMed

Other PDB entries of the same protein (UniProt O00206 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Z62 1.7 Å, Crystal structure of the TV3 hybrid of human TLR4 and hagfish VLRB.61
2Z63 2.0 Å, Crystal structure of the TV8 hybrid of human TLR4 and hagfish VLRB.61
8WO1 2.24 Å, Cryo-EM Structure of Human TLR4/MD-2/DLAM5 Complex
3UL7 2.37 Å, Crystal structure of the TV3 mutant F63W
4G8A 2.4 Å, Crystal structure of human TLR4 polymorphic variant D299G and T399I in complex with MD-2…
3UL9 2.45 Å, structure of the TV3 mutant M41E
3UL8 2.5 Å, Crystal structure of the TV3 mutant V134L
2Z65 2.7 Å, Crystal structure of the human TLR4 TV3 hybrid-MD-2-Eritoran complex
9J03 2.7 Å, Cyro-EM Structure of Human TLR4/MD-2/DLAM1 Complex
8WTA 2.9 Å, Cryo-EM Structure of Human TLR4/MD-2/DLAM3 Complex
3FXI 3.1 Å, Crystal structure of the human TLR4-human MD-2-E.coli LPS Ra complex
3ULA 3.6 Å, Crystal structure of the TV3 mutant F63W-MD-2-Eritoran complex

Browse structure collections

About this viewer

MolViewer shows 2Z66 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.