2Z8C: Phosphorylated insulin receptor tyrosine kinase

Phosphorylated insulin receptor tyrosine kinase in complex with (4-{[5-carbamoyl-4-(3-methylanilino)pyrimidin-2-yl]amino}phenyl)acetic acid. Determined by X-ray diffraction at 3.25 Å resolution. Released 12 Aug 2008.

Method: X-ray diffraction
Resolution: 3.25 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,466
Mol. weight: 35.83 kDa
Ligands: S91
Released: 12 Aug 2008

Explore 2Z8C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Z8C contains 17 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	990	1	1
α-helix	993-995	3
β-strand	997-1004	8	1
β-strand	1009-1014	6	1
β-strand	1016	1	2
β-strand	1024	1	2
β-strand	1027-1031	5	1
α-helix	1038-1049	12
β-strand	1059	1	3
α-helix	1060-1061	2
β-strand	1062-1066	5	1
β-strand	1073-1077	5	1
β-strand	1083	1	3
α-helix	1084-1089	6
α-helix	1106-1125	20
β-strand	1128-1129	2	4
α-helix	1135-1137	3
β-strand	1138-1140	3	3
β-strand	1146-1148	3	3
β-strand	1155-1156	2	4
β-strand	1169-1170	2	5
α-helix	1173-1175	3
α-helix	1178-1181	4
α-helix	1188-1204	17
α-helix	1207-1208	2
α-helix	1215-1224	10
α-helix	1236-1245	10
α-helix	1250-1252	3
α-helix	1254-1255	2
α-helix	1256-1261	6
α-helix	1264-1266	3
α-helix	1271-1274	4

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	12-13	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin receptor	A	protein	303	Homo sapiens	P06213 (AlphaFold model)
6-mer peptide from Insulin receptor substrate 1	B	protein	6	Homo sapiens	P35568 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Z8C_1 Insulin receptor (chains A)
SSVFVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRE
RIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPG
RPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYET
DYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLK
FVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSE
ENK

Sequence of entity 2 (B), FASTA

>2Z8C_2 6-mer peptide from Insulin receptor substrate 1 (chains B)
DYMNMS

Ligands and cofactors

ID	Name	Formula	Copies
S91	[4-({5-(aminocarbonyl)-4-[(3-methylphenyl)amino]pyrimidin-2-yl}amino)phenyl]ace…	C20 H19 N5 O3	1

Primary citation

Identification of a key element for hydrogen-bonding patterns between protein kinases and their inhibitors. Katayama, N., Orita, M., Yamaguchi, T. et al. Proteins (2008) 73:795-801. DOI 10.1002/prot.22207 · PubMed

Other PDB entries of the same protein (UniProt P06213 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BU3 1.65 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide
5HHW 1.79 Å, Crystal structure of insulin receptor kinase domain in complex with…
4IBM 1.8 Å, Crystal structure of insulin receptor kinase domain in complex with an inhibitor Irfin-1
5U1M 1.8 Å, Structure of the IRS-1 PTB Domain Bound to the Juxtamembrane Region of the Insulin…
1IR3 1.9 Å, Phosphorylated insulin receptor tyrosine kinase in complex with peptide substrate and…
1P14 1.9 Å, Crystal structure of a catalytic-loop mutant of the insulin receptor tyrosine kinase
3BU6 1.95 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB phosphopeptide
1IRK 2.1 Å, Crystal structure of the tyrosine kinase domain of the human insulin receptor
3BU5 2.1 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide and ATP
3EKK 2.1 Å, Insulin receptor kinase complexed with an inhibitor
8DWN 2.15 Å, Crystal structure of bis-phosphorylated insulin receptor kinase domain
3EKN 2.2 Å, Insulin receptor kinase complexed with an inhibitor

Browse structure collections

About this viewer

MolViewer shows 2Z8C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.