2ZCH: Human prostate specific antigen

Crystal structure of human prostate specific antigen complexed with an activating antibody. Determined by X-ray diffraction at 2.83 Å resolution. Released 29 Jan 2008.

Method: X-ray diffraction
Resolution: 2.83 Å
Organisms: Homo sapiens, Mus musculus
Chains: 3
Atoms: 5,290
Mol. weight: 74.51 kDa
Ligands: NDG, PO4
Released: 29 Jan 2008

Explore 2ZCH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZCH contains 23 α-helices and 61 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	12
β-strand	10-12	3	13
β-strand	18-25	8	12
α-helix	29-31	3
β-strand	33-39	7	13
β-strand	45-51	7	13
β-strand	57-59	3	13
α-helix	61-63	3
β-strand	67-72	6	12
α-helix	73-75	3
β-strand	77-82	6	12
α-helix	84-86	3
β-strand	88-95	8	13
β-strand	100E-103	4	13
β-strand	107-111	5	13
β-strand	121-124	4	14
α-helix	125-127	3
β-strand	135-145	11	14
β-strand	151-154	4	15
α-helix	155-157	3
β-strand	162-165	4	14
α-helix	166-168	3
β-strand	169-171	3	14
β-strand	174-184	11	14
β-strand	194-199	6	15
α-helix	200-202	3
β-strand	204-209	6	15

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-14	5	7
β-strand	19-25	7	6
β-strand	27C	1	8
β-strand	31	1	8
β-strand	33-38	6	7
β-strand	45-49	5	7
β-strand	53-54	2	7
α-helix	55	1
β-strand	62-67	6	6
β-strand	70-75	6	6
α-helix	80-82	3
β-strand	84-90	7	7
α-helix	96	1
β-strand	97-98	2	7
β-strand	102-107	6	7
β-strand	111	1	9
β-strand	114-118	5	10
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	10
β-strand	140	1	9
β-strand	144-150	7	11
β-strand	155	1	11
β-strand	159-163	5	10
α-helix	164-167	4
β-strand	173-182	10	10
α-helix	183-187	5
β-strand	192-198	7	11
β-strand	205-209	5	11

Chain P: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
β-strand	30-34	5	3
β-strand	39-48	9	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	64-67	4	3
β-strand	71	1	4
β-strand	81-90	10	3
α-helix	95A-95D	4
β-strand	98	1	5
β-strand	104-108	5	3
α-helix	111-113	3
α-helix	120-124	5
α-helix	130-131	2
β-strand	135-140	6	2
β-strand	154	1	4
β-strand	156-163	8	2
α-helix	165-171	7
β-strand	175	1	5
β-strand	180-184	5	2
β-strand	189	1	1
β-strand	198-200	3	2
β-strand	209-215	7	2
β-strand	226-230	5	2
α-helix	231-234	4
α-helix	235-243	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prostate-specific antigen	P	protein	237	Homo sapiens	P07288 (AlphaFold model)
monoclonal antibody 8G8F5 Fab	L	protein	215	Mus musculus	P01665 (AlphaFold model)
monoclonal antibody 8G8F5 Fab	H	protein	229	Mus musculus	P01863 (AlphaFold model)

Sequence of entity 1 (P), FASTA

>2ZCH_1 Prostate-specific antigen (chains P)
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPE
DTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQ
EPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTG
GKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Sequence of entity 2 (L), FASTA

>2ZCH_2 monoclonal antibody 8G8F5 Fab (chains L)
DIVLTQSPASLAVSLGQRATISCKASQSVDFDGDSYMNWYQQKPGQPPKLLIFAASNLAS
GIPARLSGSGSGTDFTLNIQPVEEEDAATYYCQQSNEDPYTFGGGTKLEIKRADAAPTVS
IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS
STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR

Sequence of entity 3 (H), FASTA

>2ZCH_3 monoclonal antibody 8G8F5 Fab (chains H)
QVQLQQSGDDLVKPGASVKLSCKASGYTFTTYYINWMRQRPGQGLEWIGRIAPASGTTYS
SEMFKDKATLTVDTSSNTAYIQLSSLSSEDSAVYFCARADYGFNSGEAMDYWGQGTSVTV
SSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWNSGSLSSGVHTFPAVLQ
SDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRDCGCKPC

Ligands and cofactors

ID	Name	Formula	Copies
NDG	2-acetamido-2-deoxy-alpha-D-glucopyranose	C8 H15 N O6	2
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody. Michel, S., Muller, B.H., Bossus, M. et al. J Mol Biol (2008) 376:1021-1033. DOI 10.1016/j.jmb.2007.11.052 · PubMed

Other PDB entries of the same protein (UniProt P07288 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9F1I 1.38 Å, Crystal structure of a first-in-class antibody for alpha-1,6-fucosylated…
9ZJQ 2.2 Å, Human KLK3 following acylation by CDD-3290
2ZCK 3.1 Å, Crystal structure of a ternary complex between PSA, a substrat-acyl intermediate and an…
3QUM 3.2 Å, Crystal structure of human prostate specific antigen (PSA) in Fab sandwich with a high…
2ZCL 3.25 Å, Crystal structure of human prostate specific antigen complexed with an activating antibody

Browse structure collections

About this viewer

MolViewer shows 2ZCH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.