2ZCK: Prostate-specific antigen

Crystal structure of a ternary complex between PSA, a substrat-acyl intermediate and an activating antibody. Determined by X-ray diffraction at 3.1 Å resolution. Released 29 Jan 2008.

Method: X-ray diffraction
Resolution: 3.1 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 5,329
Mol. weight: 75.56 kDa
Released: 29 Jan 2008

Explore 2ZCK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZCK contains 21 α-helices and 65 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	13
β-strand	10-12	3	14
β-strand	18-25	8	13
α-helix	29-31	3
β-strand	33-39	7	14
β-strand	45-52	8	14
β-strand	56-59	4	14
β-strand	67-72	6	13
α-helix	73-75	3
β-strand	77-82	6	13
β-strand	88-95	8	14
α-helix	96	1
β-strand	100E-103	4	14
β-strand	108-111	4	14
α-helix	118-120	3
β-strand	121-123	3	15
β-strand	135-145	11	15
β-strand	151-154	4	16
β-strand	163-165	3	15
α-helix	166-168	3
β-strand	169-170	2	15
β-strand	175-184	10	15
β-strand	194-198	5	16
β-strand	205-209	5	16

Chain L: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-13	4	7
β-strand	19-25	7	6
β-strand	27C-27D	2	8
β-strand	30-31	2	8
β-strand	33-38	6	7
β-strand	45-49	5	7
β-strand	53-54	2	7
α-helix	55	1
β-strand	62-67	6	6
β-strand	70-75	6	6
α-helix	80-82	3
β-strand	84-90	7	7
α-helix	96	1
β-strand	97-98	2	7
β-strand	103-106	4	7
α-helix	107	1
β-strand	111	1	9
β-strand	114-118	5	10
α-helix	122-125	4
β-strand	129-139	11	10
β-strand	140	1	9
β-strand	144-148	5	11
β-strand	159-160	2	10
β-strand	163	1	10
β-strand	167	1	12
β-strand	172	1	12
β-strand	173-182	10	10
α-helix	183-186	4
β-strand	192-198	7	11
β-strand	206-209	4	11

Chain P: 10 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-35	6	3
β-strand	38-48	10	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	64-66	3	3
β-strand	71	1	4
β-strand	82-90	9	3
α-helix	95A-95D	4
β-strand	95I	1	2
α-helix	95J	1
β-strand	98	1	5
β-strand	104-108	5	3
α-helix	111-114	4
α-helix	122-124	3
α-helix	129-131	3
β-strand	135-140	6	2
β-strand	154	1	4
β-strand	156-162	7	2
α-helix	165-171	7
β-strand	175	1	5
β-strand	180-184	5	2
β-strand	189	1	1
β-strand	198-201	4	2
β-strand	208-217	10	2
β-strand	227-231	5	2
α-helix	232-235	4
α-helix	236-244	9

Chain S: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	501-503	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prostate-specific antigen	P	protein	237	Homo sapiens	P07288 (AlphaFold model)
Kgissqy	S	protein	7
monoclonal antibody 8G8F5 Fab	L	protein	218	Mus musculus	P01665 (AlphaFold model)
monoclonal antibody 8G8F5 Fab	H	protein	230	Mus musculus	P01863 (AlphaFold model)

Sequence of entity 1 (P), FASTA

>2ZCK_1 Prostate-specific antigen (chains P)
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPE
DTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQ
EPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTG
GKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Sequence of entity 2 (S), FASTA

>2ZCK_2 KGISSQY (chains S)
KGISSQY

Sequence of entity 3 (L), FASTA

>2ZCK_3 monoclonal antibody 8G8F5 Fab (chains L)
DIVLTQSPASLAVSLGQRATISCKASQSVDFDGDSYMNWYQQKPGQPPKLLIFAASNLAS
GIPARLSGSGSGTDFTLNIQPVEEEDAATYYCQQSNEDPYTFGGGTKLEIKRADAAPTVS
IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS
STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 4 (H), FASTA

>2ZCK_4 monoclonal antibody 8G8F5 Fab (chains H)
QVQLQQSGDDLVKPGASVKLSCKASGYTFTTYYINWMRQRPGQGLEWIGRIAPASGTTYS
SEMFKDKATLTVDTSSNTAYIQLSSLSSEDSAVYFCARADYGFNSGEAMDYWGQGTSVTV
SSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWNSGSLSSGVHTFPAVLQ
SDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRDCGCKPCI

Primary citation

Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody. Michel, S., Muller, B.H., Bossus, M. et al. J Mol Biol (2008) 376:1021-1033. DOI 10.1016/j.jmb.2007.11.052 · PubMed

Other PDB entries of the same protein (UniProt P07288 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9F1I 1.38 Å, Crystal structure of a first-in-class antibody for alpha-1,6-fucosylated…
9ZJQ 2.2 Å, Human KLK3 following acylation by CDD-3290
2ZCH 2.83 Å, Crystal structure of human prostate specific antigen complexed with an activating antibody
3QUM 3.2 Å, Crystal structure of human prostate specific antigen (PSA) in Fab sandwich with a high…
2ZCL 3.25 Å, Crystal structure of human prostate specific antigen complexed with an activating antibody

Browse structure collections

About this viewer

MolViewer shows 2ZCK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.