2ZTA: GCN4 leucine zipper

Name: PDB 2ZTA: X-ray structure of the GCN4 leucine zipper, a two-stranded, parallel coiled coil
Published: 1992-10-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: leucine zipper

X-ray structure of the GCN4 leucine zipper, a two-stranded, parallel coiled coil. Determined by X-ray diffraction at 1.8 Å resolution. Released 15 Oct 1992.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 576
Mol. weight: 8.06 kDa
Released: 15 Oct 1992

Explore 2ZTA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZTA contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-30	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GCN4 leucine zipper	A, B	protein	34	Saccharomyces cerevisiae	P03069 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2ZTA_1 GCN4 LEUCINE ZIPPER (chains A, B)
XRMKQLEDKVEELLSKNYHLENEVARLKKLVGER

Primary citation

X-ray structure of the GCN4 leucine zipper, a two-stranded, parallel coiled coil. O'Shea, E.K., Klemm, J.D., Kim, P.S. et al. Science (1991) 254:539-544. PubMed

Other PDB entries of the same protein (UniProt P03069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AZD 0.98 Å, Crystal structure of tropomyosin N-terminal fragment at 0.98A resolution
2WQ1 1.08 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating bromide
2WQ0 1.12 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride
4OWI 1.2 Å, peptide structure
2WQ3 1.22 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride and nitrate
2HY6 1.25 Å, A seven-helix coiled coil
2WPZ 1.25 Å, GCN4 leucine zipper mutant with two VxxNxxx motifs coordinating chloride
6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
2IPZ 1.35 Å, A Parallel Coiled-Coil Tetramer with Offset Helices
2YNY 1.35 Å, Salmonella enterica SadA 255-302 fused to GCN4 adaptors (SadAK1)
5APU 1.35 Å, Sequence IANKEDKAD inserted between GCN4 adaptors - Structure A9b black
2WQ2 1.36 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating iodide

Browse more

2ZTA is part of these collections:

Classic small proteins for teaching

About this viewer

MolViewer shows 2ZTA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.