3A62: Phosphorylated p70S6K1

Crystal structure of phosphorylated p70S6K1. Determined by X-ray diffraction at 2.35 Å resolution. Released 27 Oct 2009.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,190
Mol. weight: 37.54 kDa
Ligands: STU, MN
Released: 27 Oct 2009

Explore 3A62 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3A62 contains 14 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	88-90	3
β-strand	91-100	10	1
β-strand	103-110	8	1
β-strand	119-125	7	1
α-helix	143-149	7
β-strand	155	1	2
α-helix	156-157	2
β-strand	158-163	6	1
β-strand	168-173	6	1
β-strand	178-179	2	2
α-helix	180-187	8
α-helix	192-211	20
β-strand	224-226	3	2
β-strand	232-234	3	2
α-helix	262-265	4
α-helix	273-288	16
α-helix	298-307	10
α-helix	318-327	10
α-helix	332-334	3
α-helix	343-348	6
α-helix	350-352	3
α-helix	357-361	5
α-helix	366-367	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosomal protein S6 kinase beta-1	A	protein	327	Homo sapiens	P23443 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3A62_1 Ribosomal protein S6 kinase beta-1 (chains A)
GSSETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVR
NAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFME
DTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHT
FCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNL
PPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPL
LQSEEDVSQFDSKFTRQTPVDSPDDST

Ligands and cofactors

ID	Name	Formula	Copies
STU	Staurosporine	C28 H26 N4 O3	1
MN	Manganese (II) ion	Mn	1

Primary citation

Structural basis of human p70 ribosomal S6 kinase-1 regulation by activation loop phosphorylation. Sunami, T., Byrne, N., Diehl, R.E. et al. J Biol Chem (2010) 285:4587-4594. DOI 10.1074/jbc.M109.040667 · PubMed

Other PDB entries of the same protein (UniProt P23443 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WBH 1.75 Å, Structure of the FRB domain of mTOR bound to a substrate recruitment peptide of S6K1
3WF7 1.85 Å, Crystal structure of S6K1 kinase domain in complex with a purine derivative…
3WF8 1.98 Å, Crystal structure of S6K1 kinase domain in complex with a quinoline derivative…
3WE4 2.0 Å, Crystal structure of S6K1 kinase domain in complex with a pyrimidine derivative…
3WF6 2.03 Å, Crystal structure of S6K1 kinase domain in complex with a pyrazolopyrimidine derivative…
3WF9 2.04 Å, Crystal structure of S6K1 kinase domain in complex with a quinoline derivative…
3WF5 2.1 Å, Crystal structure of S6K1 kinase domain in complex with a pyrazolopyrimidine derivative…
4L3J 2.1 Å, Crystal structures of human p70S6K1 kinase domain
4L3L 2.1 Å, Crystal structures of human p70S6K1 kinase domain (Zinc anomalous)
4RLO 2.53 Å, Human p70s6k1 with ruthenium-based inhibitor EM5
7N93 2.74 Å, P70 S6K1 in complex with MSC2363318A-1
4RLP 2.79 Å, Human p70s6k1 with ruthenium-based inhibitor FL772

Browse structure collections

About this viewer

MolViewer shows 3A62 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.